Property Summary

NCBI Gene PubMed Count 21
PubMed Score 109.37
PubTator Score 15.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q9Y316 B4DLS0 D6W575 Q5R2V8 Q5R2V9 Q6NSL5
Symbols MEMO
C2orf4
CGI-27
NS5ATP7

Gene

PDB

3BCZ   3BD0  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Protein-protein Interaction (7)

Gene RIF (11)

AA Sequence

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSI      1 - 70
TRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYT     71 - 140
AKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIY    141 - 210
RSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCR    211 - 280
NWQDSSVSYAAGALTVH                                                         281 - 297
//

Text Mined References (24)

PMID Year Title