Property Summary

NCBI Gene PubMed Count 18
Grant Count 17
R01 Count 5
Funding $5,975,148
PubMed Score 100.67
PubTator Score 15.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (8)

PMID Text
24917593 Biochemical assays revealed that Memo is a copper-dependent redox enzyme that promoted a more oxidized intracellular milieu and stimulated the production of reactive oxygen species (ROS) in cellular structures involved in migration.
23861392 Mediator of ERBB2-driven cell motility (MEMO) promotes extranuclear estrogen receptor signaling involving the growth factor receptors IGF1R and ERBB2.
22824790 MEMO1 is involved in breast carcinogenesis via regulating insulin-like growth factor-I receptor-dependent signaling events.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19223396 Memo was detected in complexes with cofilin, ErbB2 and PLCgamma1.
18955552 Memo-RhoA-mDia1 signaling coordinates the organization of the lamellipodial actin network, adhesion site formation, and microtubule outgrowth within the cell leading edge to sustain cell motility.
18045866 2.1A crystal structure and homology to class III nonheme iron-dependent dioxygenases
15156151 data suggest that Memo controls cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton [Memo]

AA Sequence

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSI      1 - 70
TRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYT     71 - 140
AKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIY    141 - 210
RSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCR    211 - 280
NWQDSSVSYAAGALTVH                                                         281 - 297
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24917593 2014 Memo is a copper-dependent redox protein with an essential role in migration and metastasis.
23861392 2013 Mediator of ERBB2-driven cell motility (MEMO) promotes extranuclear estrogen receptor signaling involving the growth factor receptors IGF1R and ERBB2.
22824790 2013 MEMO1, a new IRS1-interacting protein, induces epithelial-mesenchymal transition in mammary epithelial cells.
21840311 2011 MEMO associated with an ErbB2 receptor phosphopeptide reveals a new phosphotyrosine motif.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20937854 2010 ErbB2 receptor controls microtubule capture by recruiting ACF7 to the plasma membrane of migrating cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...