Property Summary

NCBI Gene PubMed Count 11
PubMed Score 133.06
PubTator Score 40.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.197 0.007
astrocytoma 1.500 0.000
glioblastoma 1.600 0.001
oligodendroglioma 1.300 0.000
tuberculosis 1.300 0.000
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.100 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
aldosterone-producing adenoma -1.060 0.044
ovarian cancer 2.000 0.004
dermatomyositis 1.900 0.001

Synonym

Accession Q9Y315 Q53HN9 Q6PHW2 DERA
Symbols DEOC
CGI-26

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSAHNRGTELDLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQR      1 - 70
LCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRL     71 - 140
EEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRKACGEAHLKTILATGELGTLTNVYKASMIAM    141 - 210
MAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEW    211 - 280
LKPELFRIGASTLLSDIERQIYHHVTGRYAAYHDLPMS                                    281 - 318
//

Text Mined References (14)

PMID Year Title
25229427 2014 DERA is the human deoxyribose phosphate aldolase and is involved in stress response.
25027321 2014 Genome-wide association and admixture analysis of glaucoma in the Women's Health Initiative.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12546782 2003 Phylogenetic analyses of diplomonad genes reveal frequent lateral gene transfers affecting eukaryotes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...