Property Summary

NCBI Gene PubMed Count 14
Grant Count 10
R01 Count 9
Funding $692,322.87
PubMed Score 8.28
PubTator Score 3.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Chronic Lymphocytic Leukemia 2.385 0.000
Multiple myeloma 1.187 0.002
psoriasis 1.400 0.000
osteosarcoma -1.165 0.001
primary pancreatic ductal adenocarcinoma -1.824 0.001
lung cancer 1.400 0.004
ovarian cancer 2.500 0.000
pancreatic cancer -1.700 0.001

Gene RIF (2)

PMID Text
16135813 Endogenous NOSIP reduces the enzymatic capacity of eNOS, specifically in the G(2) phase of the cell cycle by targeting eNOS to the actin cytoskeleton.
11149895 endothelial nitric oxide synthase (eNOS) interacting protein (NOSIP), modulator of eNOS activity by alteration of eNOS subcellular localisation; high expression levels in endothelial cells and vascularized tissue.

AA Sequence

MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAI      1 - 70
LEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPD     71 - 140
DVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVD    141 - 210
RVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGG    211 - 280
TGFAGSGVKLQAEKSRPVMQA                                                     281 - 301
//

Text Mined References (22)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20082095 2010 Cellular signaling and NO production.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...