Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.83
PubTator Score 3.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Chronic Lymphocytic Leukemia 2.385 3.0e-05
lung cancer 1.400 4.3e-03
Multiple myeloma 1.187 2.3e-03
osteosarcoma -1.165 1.1e-03
ovarian cancer 2.500 2.3e-07
pancreatic cancer -1.700 6.4e-04
primary pancreatic ductal adenocarcinoma -1.824 7.2e-04
psoriasis 1.400 3.9e-04

Gene RIF (3)

AA Sequence

MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAI      1 - 70
LEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPD     71 - 140
DVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVD    141 - 210
RVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGG    211 - 280
TGFAGSGVKLQAEKSRPVMQA                                                     281 - 301
//

Text Mined References (23)

PMID Year Title