Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.57
PubTator Score 2.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 3.14 1.6

Expression

Synonym

Accession Q9Y312 E1P5S7 Q9H4F9 Q9P1P3 Q9UFK9
Symbols CGI-23
C20orf4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAAVQMDPELAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKE      1 - 70
VGPRMGFFLSLHQRGLTVLRWSTLREEVDLSPAPESEVEAMRANLQELDQFLGPYPYATLKKWISLTNFI     71 - 140
SEATVEKLQPENRQICAFSDVLPVLSMKHTKDRVGQNLPRCGIECKSYQEGLARLPEMKPRAGTEIRFSE    141 - 210
LPTQMFPEGATPAEITKHSMDLSYALETVLNKQFPSSPQDVLGELQFAFVCFLLGNVYEAFEHWKRLLNL    211 - 280
LCRSEAAMMKHHTLYINLISILYHQLGEIPADFFVDIVSQDNFLTSTLQVFFSSACSIAVDATLRKKAEK    281 - 350
FQAHLTKKFRWDFAAEPEDCAPVVVELPEGIEMG                                        351 - 384
//

Text Mined References (13)

PMID Year Title