Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.40
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -2.053 0.000
glioblastoma 1.300 0.003
group 4 medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.500 0.003
primitive neuroectodermal tumor -1.600 0.021
non-small cell lung cancer -1.142 0.000
lung cancer 1.300 0.037
subependymal giant cell astrocytoma 1.013 0.020
lung carcinoma -1.600 0.000
ovarian cancer -2.100 0.000

Synonym

Accession Q9Y305 B3KNC9 B7ZM94 Acyl-CoA thioesterase 9
Symbols ACATE2
CGI-16
MTACT48
MT-ACT48

Gene

PANTHER Protein Class (2)

AA Sequence

MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSF      1 - 70
LAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMS     71 - 140
PLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSEN    141 - 210
KGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRV    211 - 280
LPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVE    281 - 350
VGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQR    351 - 420
HFNSMSGPATLRKDYLVEP                                                       421 - 439
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16103133 2005 A revised nomenclature for mammalian acyl-CoA thioesterases/hydrolases.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...