Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.45
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.300 3.1e-03
group 4 medulloblastoma -1.400 1.8e-04
lung cancer 1.300 3.7e-02
lung carcinoma -1.600 2.0e-30
medulloblastoma, large-cell -1.500 3.1e-03
non-small cell lung cancer -1.142 2.3e-16
osteosarcoma -2.053 3.2e-05
ovarian cancer -2.100 3.3e-08
primitive neuroectodermal tumor -1.600 2.1e-02
subependymal giant cell astrocytoma 1.013 2.0e-02

AA Sequence

MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSF      1 - 70
LAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMS     71 - 140
PLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSEN    141 - 210
KGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRV    211 - 280
LPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVE    281 - 350
VGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQR    351 - 420
HFNSMSGPATLRKDYLVEP                                                       421 - 439
//

Text Mined References (12)

PMID Year Title