Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.40
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.02540130976738E-30
non-small cell lung cancer 2798 2.30289386870227E-16
ovarian cancer 8492 3.26925393436191E-8
osteosarcoma 7933 3.19088413841846E-5
group 4 medulloblastoma 1875 1.81381594693337E-4
medulloblastoma, large-cell 6234 0.00306968331361828
glioblastoma 5572 0.0030983441188471
subependymal giant cell astrocytoma 2287 0.0200253671428742
primitive neuroectodermal tumor 3031 0.0205238220131447
lung cancer 4473 0.0368236562339746
Disease Target Count Z-score Confidence
Kabuki syndrome 29 5.023 2.5

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -2.053 0.000
glioblastoma 1.300 0.003
group 4 medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.500 0.003
primitive neuroectodermal tumor -1.600 0.021
non-small cell lung cancer -1.142 0.000
lung cancer 1.300 0.037
subependymal giant cell astrocytoma 1.013 0.020
lung carcinoma -1.600 0.000
ovarian cancer -2.100 0.000

Synonym

Accession Q9Y305 B3KNC9 B7ZM94 Acyl-CoA thioesterase 9
Symbols ACATE2
CGI-16
MTACT48
MT-ACT48

Gene

PANTHER Protein Class (2)

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

AA Sequence

MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSF      1 - 70
LAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMS     71 - 140
PLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSEN    141 - 210
KGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRV    211 - 280
LPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVE    281 - 350
VGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQR    351 - 420
HFNSMSGPATLRKDYLVEP                                                       421 - 439
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16103133 2005 A revised nomenclature for mammalian acyl-CoA thioesterases/hydrolases.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...