Property Summary

NCBI Gene PubMed Count 10
PubMed Score 18.46
PubTator Score 7.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MAARLVSRCGAVRAAPHSGPLVSWRRWSGASTDTVYDVVVSGGGLVGAAMACALGYDIHFHDKKILLLEA      1 - 70
GPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMG     71 - 140
YIVENDVIMHALTKQLEAVSDRVTVLYRSKAIRYTWPCPFPMADSSPWVHITLGDGSTFQTKLLIGADGH    141 - 210
NSGVRQAVGIQNVSWNYDQSAVVATLHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAE    211 - 280
LVSMDEEKFVDAVNSAFWSDADHTDFIDTAGAMLQYAVSLLKPTKVSARQLPPSVARVDAKSRVLFPLGL    281 - 350
GHAAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDISSLAHHLSTAAFNGKDLGSVSHLTGYETERQRHN    351 - 420
TALLAATDLLKRLYSTSASPLVLLRTWGLQATNAVSPLKEQIMAFASK                          421 - 468
//

Text Mined References (15)

PMID Year Title