Property Summary

NCBI Gene PubMed Count 22
PubMed Score 260.85
PubTator Score 13.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 5.0e-07
medulloblastoma, large-cell 1.100 1.3e-03
osteosarcoma -1.014 3.7e-03
ovarian cancer -1.200 1.8e-04
pancreatic ductal adenocarcinoma liver m... -1.039 4.0e-03
primary Sjogren syndrome 1.200 2.2e-03
psoriasis 1.200 1.1e-03

Gene RIF (13)

AA Sequence

MFYFRGCGRWVAVSFTKQQFPLARLSSDSAAPRTPHFDVIVIGGGHAGTEAATAAARCGSRTLLLTHRVD      1 - 70
TIGQMSCNPSFGGIGKGHLMREVDALDGLCSRICDQSGVHYKVLNRRKGPAVWGLRAQIDRKLYKQNMQK     71 - 140
EILNTPLLTVQEGAVEDLILTEPEPEHTGKCRVSGVVLVDGSTVYAESVILTTGTFLRGMIVIGLETHPA    141 - 210
GRLGDQPSIGLAQTLEKLGFVVGRLKTGTPPRIAKESINFSILNKHIPDNPSIPFSFTNETVWIKPEDQL    211 - 280
PCYLTHTNPRVDEIVLKNLHLNSHVKETTRGPRYCPSIESKVLRFPNRLHQVWLEPEGMDSDLIYPQGLS    281 - 350
MTLPAELQEKMITCIRGLEKAKVIQPDGVLLLLPRMECNGAISAHHNLPLPGYGVQYDYLDPRQITPSLE    351 - 420
THLVQRLFFAGQINGTTGYEEAAAQGVIAGINASLRVSRKPPFVVSRTEGYIGVLIDDLTTLGTSEPYRM    421 - 490
FTSRVEFRLSLRPDNADSRLTLRGYKDAGCVSQQRYERACWMKSSLEEGISVLKSIEFLSSKWKKLIPEA    491 - 560
SISTSRSLPVRALDVLKYEEVDMDSLAKAVPEPLKKYTKCRELAERLKIEATYESVLFHQLQEIKGVQQD    561 - 630
EALQLPKDLDYLTIRDVSLSHEVREKLHFSRPQTIGAASRIPGVTPAAIINLLRFVKTTQRRQSAMNESS    631 - 700
KTDQYLCDADRLQEREL                                                         701 - 717
//

Text Mined References (25)

PMID Year Title