Property Summary

NCBI Gene PubMed Count 36
PubMed Score 9.93
PubTator Score 35.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.800 1.1e-03
Amyotrophic lateral sclerosis 1.202 6.2e-06
atypical teratoid / rhabdoid tumor -1.500 4.0e-05
Breast cancer 2.700 2.4e-02
gastric cancer 1.200 3.2e-04
glioblastoma -1.100 3.8e-03
invasive ductal carcinoma -1.500 7.7e-03
medulloblastoma -1.100 1.3e-04
medulloblastoma, large-cell -1.100 4.9e-04
non-small cell lung cancer -1.328 7.9e-15
osteosarcoma 1.038 5.7e-04
ovarian cancer -1.100 3.0e-04
psoriasis -1.100 1.7e-23

 MGI Phenotype (1)

Gene RIF (17)

AA Sequence

MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK      1 - 70
SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGI     71 - 140
TGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALV    141 - 210
KLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSS    211 - 280
SPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKR    281 - 350
KVEINPPDDMEWKKY                                                           351 - 365
//

Text Mined References (49)

PMID Year Title