Property Summary

NCBI Gene PubMed Count 33
Grant Count 17
R01 Count 16
Funding $973,911.51
PubMed Score 9.74
PubTator Score 35.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
gastric cancer 1.200 0.000
osteosarcoma -2.129 0.000
glioblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.900 0.000
Amyotrophic Lateral Sclerosis 1.202 0.000
non-small cell lung cancer -1.328 0.000
Breast cancer 2.700 0.024
adult high grade glioma -1.800 0.001
psoriasis -1.100 0.000
invasive ductal carcinoma -1.500 0.008
ovarian cancer -2.400 0.000

Gene RIF (14)

PMID Text
23935490 Data suggest that SspH2 (ubiquitin ligase effector from Salmonella typhimurium) ubiquitination activity and protein stability is enhanced by SGT1.
23440515 our data revealed a previously uncovered role of SGT1 in gastric cancer development, and suggested that SGT1 could be a promising anti-cancer target to against gastric cancer
23184943 Chp-1 and melusin can interact with cochaperones PP5 and Sgt1 and with each other in an ATP-dependent manner
22869522 Plk1 is required for the kinetochore localization of Sgt1 and phosphorylates serine 331 of Sgt1 at the kinetochores.
21864708 S100A6-Ca(2+)-mediated Sgt1 dephosphorylation promotes its nuclear translocation, most likely due to disruption of the Sgt1-Hsp90 complex
20404110 These findings support a novel role for Hsp90-Sgt1 chaperones in ensuring the fidelity of Mis12 multiprotein complex assembly.
20213445 Sgt1 translocates to the nucleus due to heat shock. S100A6 is necessary for nuclear translocation of the Sgt1 protein.
20126976 SUGT1 amplification might give rise to promoting transcription of the gene directly subsequent to the progression of colorectal cancer cases with worsening prognosis
19398558 protein kinase CK2 phosphorylates Ser(361) on Sgt1, and this phosphorylation inhibits Sgt1 dimerization
18358234 Sgt1 is a co-chaperone protein with an expression pattern matching that of the well known heat shock proteins.
More...

AA Sequence

MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK      1 - 70
SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGI     71 - 140
TGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALV    141 - 210
KLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSS    211 - 280
SPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKR    281 - 350
KVEINPPDDMEWKKY                                                           351 - 365
//

Text Mined References (45)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23935490 2013 The Salmonella type III effector SspH2 specifically exploits the NLR co-chaperone activity of SGT1 to subvert immunity.
23440515 2013 SGT1 regulates Akt signaling by promoting beta-TrCP-dependent PHLPP1 degradation in gastric cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184943 2013 Dynamic nucleotide-dependent interactions of cysteine- and histidine-rich domain (CHORD)-containing Hsp90 cochaperones Chp-1 and melusin with cochaperones PP5 and Sgt1.
22869522 2012 Plk1 phosphorylates Sgt1 at the kinetochores to promote timely kinetochore-microtubule attachment.
More...