Property Summary

NCBI Gene PubMed Count 26
PubMed Score 25.15
PubTator Score 20.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Endometriosis 535
Disease Target Count P-value
lung adenocarcinoma 2714 2.8909966234978E-23
osteosarcoma 7933 2.60046366725476E-6
ovarian cancer 8492 5.32498517377469E-6
psoriasis 6685 7.66226552473111E-5
group 4 medulloblastoma 1875 4.0246058185444E-4
glioblastoma 5572 5.73323060016196E-4
ependymoma 2514 6.07792123465162E-4
subependymal giant cell astrocytoma 2287 0.00166374746809243
Multiple myeloma 1328 0.00202204995587492
atypical teratoid / rhabdoid tumor 4369 0.00235536513787464
medulloblastoma, large-cell 6234 0.00269499055967309
adult high grade glioma 2148 0.00299326414059579
acute quadriplegic myopathy 1157 0.00470659927455971
pancreatic cancer 2300 0.00576900679326843
primary pancreatic ductal adenocarcinoma 1271 0.00594359697034564
gastric carcinoma 832 0.00650562122454393
invasive ductal carcinoma 2950 0.0153655464328311
aldosterone-producing adenoma 664 0.0243551838943665

Expression

  Differential Expression (18)

Disease log2 FC p
Multiple myeloma 1.350 0.002
psoriasis 2.700 0.000
osteosarcoma 2.772 0.000
ependymoma -1.100 0.001
glioblastoma -1.200 0.001
group 4 medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.700 0.002
medulloblastoma, large-cell -1.700 0.003
acute quadriplegic myopathy 1.256 0.005
primary pancreatic ductal adenocarcinoma 1.257 0.006
adult high grade glioma -1.400 0.003
aldosterone-producing adenoma -1.045 0.024
subependymal giant cell astrocytoma -2.579 0.002
lung adenocarcinoma -2.300 0.000
gastric carcinoma 1.500 0.007
invasive ductal carcinoma -1.200 0.015
ovarian cancer 2.400 0.000
pancreatic cancer 1.400 0.006

Synonym

Accession Q9Y2Y9 Q9Y356
Symbols BTEB3
FKLF2
NSLP1
RFLAT1
RFLAT-1

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (13)

PMID Text
22797700 Knockdown of either FBW7gamma or GSK3beta by small interfering RNA increases KLF13 expression in resting human T lymphocytes.
20539070 KLF13 contributes to malignancy in oral cancer cells and may be a useful biomarker fo early detection and da possible target for therapy.
20518834 No associations were found between maternal genetic polymorphisms in RANTES (-403G/A) and mother-to-child HIV-1 transmission; plasma, cervical and breastmilk viral loads; or breastmilk chemokine concentrations.
20410205 Data support cross-regulation among BMP2, KLF9, and KLF13 to maintain progesterone sensitivity in stromal cells undergoing differentiation and suggest that loss of this network compromises establishment of uterine receptivity and implantation success.
18056793 Transient transfection of Kruppel-like factor 4 suppressed LDLR, steroidogenic acute regulatory protein, and CYP11A
17513757 Coexpression of PRP4 and KLF13 increases nuclear localization of KLF13 and CCL5 transcription.
17074812 KLF13 is a key regulator of late RANTES expression in T lymphocytes
16023392 In co-transfection assays in K562 cells, it was demonstrated that KLF2, 5 and 13 positively regulate, and KLF8 negatively regulates, the gamma-globin gene through the CACCC promoter element.
15937668 Observational study of gene-disease association. (HuGE Navigator)
15716005 Feedback mechanism for the transcriptional control of the KLF13 gene in the erythroid environment.
More...

AA Sequence

MAAAAYVDHFAAECLVSMSSRAVVHGPREGPESRPEGAAVAATPTLPRVEERRDGKDSASLFVVARILAD      1 - 70
LNQQAPAPAPAERREGAAARKARTPCRLPPPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPA     71 - 140
GSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSWQDCNKKFAR    141 - 210
SDELARHYRTHTGEKKFSCPICEKRFMRSDHLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSP    211 - 280
TISPASSP                                                                  281 - 288
//

Text Mined References (26)

PMID Year Title
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797700 2012 Fbw7?-mediated degradation of KLF13 prevents RANTES expression in resting human but not murine T lymphocytes.
20539070 2010 Overexpression of KLF13 and FGFR3 in oral cancer cells.
20518834 2010 CCR5, RANTES and SDF-1 polymorphisms and mother-to-child HIV-1 transmission.
20410205 2010 Functional differentiation of uterine stromal cells involves cross-regulation between bone morphogenetic protein 2 and Kruppel-like factor (KLF) family members KLF9 and KLF13.
18056793 2008 Regulation of Kruppel-like factor 4, 9, and 13 genes and the steroidogenic genes LDLR, StAR, and CYP11A in ovarian granulosa cells.
17513757 2007 Interaction of PRP4 with Kruppel-like factor 13 regulates CCL5 transcription.
17074812 2007 Dynamic interplay of transcriptional machinery and chromatin regulates "late" expression of the chemokine RANTES in T lymphocytes.
More...