Property Summary

NCBI Gene PubMed Count 27
PubMed Score 27.35
PubTator Score 20.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.256 4.7e-03
adult high grade glioma -1.400 3.0e-03
aldosterone-producing adenoma -1.045 2.4e-02
atypical teratoid / rhabdoid tumor -1.600 4.1e-03
ependymoma -1.100 6.1e-04
gastric carcinoma 1.500 6.5e-03
glioblastoma -1.200 5.7e-04
group 4 medulloblastoma -2.100 4.0e-04
invasive ductal carcinoma -1.200 1.5e-02
lung adenocarcinoma -2.300 2.9e-23
medulloblastoma, large-cell -1.700 2.7e-03
Multiple myeloma 1.350 2.0e-03
osteosarcoma 2.772 2.6e-06
ovarian cancer 2.400 5.3e-06
pancreatic cancer 1.400 5.8e-03
primary pancreatic ductal adenocarcinoma 1.257 5.9e-03
psoriasis 2.700 7.7e-05
subependymal giant cell astrocytoma -1.623 3.4e-02

Gene RIF (14)

AA Sequence

MAAAAYVDHFAAECLVSMSSRAVVHGPREGPESRPEGAAVAATPTLPRVEERRDGKDSASLFVVARILAD      1 - 70
LNQQAPAPAPAERREGAAARKARTPCRLPPPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPA     71 - 140
GSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSWQDCNKKFAR    141 - 210
SDELARHYRTHTGEKKFSCPICEKRFMRSDHLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSP    211 - 280
TISPASSP                                                                  281 - 288
//

Text Mined References (27)

PMID Year Title