Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.40
PubTator Score 10.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 8.5e-12

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -6.186 8.5e-12

Synonym

Accession Q9Y2Y8
Symbols MBP2
MBPH

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (4)

AA Sequence

MQCLLLLPFLLLGTVSALHLENDAPHLESLETQADLGQDLDSSKEQERDLALTEEVIQAEGEEVKASACQ      1 - 70
DNFEDEEAMESDPAALDKDFQCPREEDIVEVQGSPRCKICRYLLVRTPKTFAEAQNVCSRCYGGNLVSIH     71 - 140
DFNFNYRIQCCTSTVNQAQVWIGGNLRGWFLWKRFCWTDGSHWNFAYWSPGQPGNGQGSCVALCTKGGYW    141 - 210
RRAQCDKQLPFVCSF                                                           211 - 225
//

Text Mined References (10)

PMID Year Title