Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.07
PubTator Score 7.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.058 2.6e-02
atypical teratoid / rhabdoid tumor 2.800 3.1e-09
ependymoma 1.500 3.4e-07
glioblastoma 1.400 2.8e-03
group 3 medulloblastoma 1.200 2.7e-02
inflammatory breast cancer -1.600 3.3e-02
lung carcinoma -1.600 4.3e-26
medulloblastoma, large-cell 1.300 4.9e-02
ovarian cancer -3.400 1.3e-13
pancreatic cancer 1.100 6.2e-03
Pick disease -1.100 4.9e-03
pituitary cancer -1.500 1.9e-04
primary pancreatic ductal adenocarcinoma 1.092 8.1e-03
primitive neuroectodermal tumor 2.000 4.0e-04
ulcerative colitis -1.600 2.6e-07

Gene RIF (4)

AA Sequence

METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT      1 - 70
NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD     71 - 140
DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD    141 - 210
KGLPGPEGFLQEQSAI                                                          211 - 226
//

Text Mined References (12)

PMID Year Title