Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.40
PubTator Score 7.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
lung carcinoma 2844 4.3451079566124E-26
ovarian cancer 8492 1.2845056675559E-13
posterior fossa group A ependymoma 1511 7.54887062585217E-11
atypical teratoid / rhabdoid tumor 4369 3.14602304780136E-9
ulcerative colitis 2087 2.63919528953486E-7
sonic hedgehog group medulloblastoma 1482 1.2947386310423E-6
pituitary cancer 1972 1.86241996150485E-4
primitive neuroectodermal tumor 3031 3.99518933635205E-4
glioblastoma 5572 0.00283215061148002
Pick disease 1893 0.00487382465185435
pancreatic cancer 2300 0.00620909623243908
primary pancreatic ductal adenocarcinoma 1271 0.00809236200399279
adrenocortical carcinoma 1427 0.0264390704440346
inflammatory breast cancer 404 0.0327552079529959
medulloblastoma, large-cell 6234 0.0486783345609988
Disease Target Count Z-score Confidence
angle-closure glaucoma 8 4.061 2.0
Hyperopia 33 3.551 1.8
Disease Target Count
Microphthalmia 79
Nanophthalmos 4 1

Expression

Synonym

Accession Q9Y2Y6 E1P631 Q9UFK2
Symbols TADA1

Gene

  Ortholog (11)

Gene RIF (4)

PMID Text
26884835 siRNA-TMEM98 inhibited the invasion and migration of non-small cell lung cancer cells.
26392740 Two novel TMEM98 mutations have been found in two pedigrees with autosomal dominant nanophthalmos.
24852644 A novel gene associated with nanophthalmos, TMEM98 most likely represents the cause of the disease.
24608572 we identified a panel of novel common chemoresistance-associated genes and demonstrated that TMEM98 is a chemoresistance-conferring gene in hepatocellular carcinoma.

AA Sequence

METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT      1 - 70
NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD     71 - 140
DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD    141 - 210
KGLPGPEGFLQEQSAI                                                          211 - 226
//

Text Mined References (12)

PMID Year Title
26884835 2015 siRNA-TMEM98 inhibits the invasion and migration of lung cancer cells.
26392740 2015 Novel TMEM98 mutations in pedigrees with autosomal dominant nanophthalmos.
24852644 2014 Mutation in TMEM98 in a large white kindred with autosomal dominant nanophthalmos linked to 17p12-q12.
24608572 2014 Identification of transmembrane protein 98 as a novel chemoresistance-conferring gene in hepatocellular carcinoma.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...