Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.40
PubTator Score 7.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26884835 siRNA-TMEM98 inhibited the invasion and migration of non-small cell lung cancer cells.
26392740 Two novel TMEM98 mutations have been found in two pedigrees with autosomal dominant nanophthalmos.
24852644 A novel gene associated with nanophthalmos, TMEM98 most likely represents the cause of the disease.
24608572 we identified a panel of novel common chemoresistance-associated genes and demonstrated that TMEM98 is a chemoresistance-conferring gene in hepatocellular carcinoma.

AA Sequence

METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT      1 - 70
NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD     71 - 140
DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD    141 - 210
KGLPGPEGFLQEQSAI                                                          211 - 226
//

Text Mined References (12)

PMID Year Title
26884835 2015 siRNA-TMEM98 inhibits the invasion and migration of lung cancer cells.
26392740 2015 Novel TMEM98 mutations in pedigrees with autosomal dominant nanophthalmos.
24852644 2014 Mutation in TMEM98 in a large white kindred with autosomal dominant nanophthalmos linked to 17p12-q12.
24608572 2014 Identification of transmembrane protein 98 as a novel chemoresistance-conferring gene in hepatocellular carcinoma.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...