Property Summary

NCBI Gene PubMed Count 16
Grant Count 17
R01 Count 13
Funding $848,173.62
PubMed Score 140.70
PubTator Score 8.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.634 0.000

Gene RIF (5)

PMID Text
20493880 confirmed that the promyelocytic leukemia zinc finger (PLZF) BTB dimer is strand exchanged in solution, while the FAZF BTB dimer is not
20147518 Here, it was shown that human endogenous retrovirus Rec can form a trimeric complex with TZFP and AR, and can relieve the TZFP-mediated repression of AR-induced transactivation.
17171645 TZFP is identified as a novel BMP2-induced transcription factor during osteoblastic differentiation.
11986317 results suggest an essential role for FAZF during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins
11964310 can interact with GATA-2 and can modify GATA-2 transactivation capacity

AA Sequence

MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPST      1 - 70
FAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPER     71 - 140
ELGDPGEKQKPEQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHG    141 - 210
VLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHST    211 - 280
PTTGAWQEVWREQRIPLSLNAPKGLWSQNQLASSSPTPGSLPQGPAQLSPGEMEESDQGHTGALATCAGH    281 - 350
EDKAGCPPRPHPPPAPPARSRPYACSVCGKRFSLKHQMETHYRVHTGEKPFSCSLCPQRSRDFSAMTKHL    351 - 420
RTHGAAPYRCSLCGAGCPSLASMQAHMRGHSPSQLPPGWTIRSTFLYSSSRPSRPSTSPCCPSSSTT       421 - 487
//

Text Mined References (16)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
20493880 2010 Insights into strand exchange in BTB domain dimers from the crystal structures of FAZF and Miz1.
20147518 2010 Human endogenous retrovirus protein Rec interacts with the testicular zinc-finger protein and androgen receptor.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
18082604 2007 A UAF1-containing multisubunit protein complex regulates the Fanconi anemia pathway.
17171645 2007 Identification of FAZF as a novel BMP2-induced transcription factor during osteoblastic differentiation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...