Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
Funding $1,859,947.5
PubMed Score 4.57
PubTator Score 494.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -1.400 0.008
ependymoma -1.400 0.025
osteosarcoma -1.054 0.000
lung cancer 1.100 0.007
breast carcinoma 1.100 0.000
Breast cancer 1.100 0.000
invasive ductal carcinoma 1.600 0.003

Synonym

Accession Q9Y2Y1 Q1W6H4 Q96S35 RNA polymerase III subunit C10
Symbols C11
My010
RPC10
RPC11
RPC12.5
C11-RNP3

Gene

Gene RIF (2)

PMID Text
17499043 Changes in Maf1 expression affect Pol III-dependent transcription in human glioblastoma lines.
1403646 HIV-1 Tat upregulates the transcription by RNA polymerase III of co-transfected or endogenous cellular Alu-repeated sequences by activating transcription factor TFIIIC

AA Sequence

MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP      1 - 70
KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD                                     71 - 108
//

Text Mined References (16)

PMID Year Title
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
21269460 2011 Initial characterization of the human central proteome.
19631370 2009 RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.
19609254 2009 RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17499043 2007 Mammalian Maf1 is a negative regulator of transcription by all three nuclear RNA polymerases.
16728641 2006 A regulatory SNP causes a human genetic disease by creating a new transcriptional promoter.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...