Property Summary

NCBI Gene PubMed Count 22
PubMed Score 9.72
PubTator Score 357.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.300 6.5e-07
osteosarcoma 2.169 2.0e-06
ovarian cancer 1.300 2.7e-05

Gene RIF (10)

AA Sequence

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYI      1 - 70
SLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLS     71 - 140
SGLVVTSLCKSSSLPASQNNLRH                                                   141 - 163
//

Text Mined References (25)

PMID Year Title