Property Summary

NCBI Gene PubMed Count 21
Grant Count 11
R01 Count 4
Funding $1,975,117.5
PubMed Score 9.74
PubTator Score 357.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
osteosarcoma 2.169 0.000
ovarian cancer 1.300 0.000

Gene RIF (10)

PMID Text
26135619 Alteration of EBV encoded miR-BART1 expression results in an increase in migration and invasion of nasopharyngeal carcinoma in vitro and causes metastasis in vivo. EBV-miR-BART1 directly targets the cellular tumour suppressor PTEN.
24899173 EBV also downregulates two immediate early genes by miR-BART20-5p.
23849777 Mutations in ARL2BP cause autosomal-recessive retinitis pigmentosa.
23685147 EBV-miR-BART1 could influence the expression of metabolism-associated genes and might be involved in cancer metabolism in nasopharyngeal carcinoma
22745590 Our results imply that BART regulates actin-cytoskeleton rearrangements at membrane ruffles through modulation of the activity of Rac1, which, in turn, inhibits pancreatic cancer cell invasion.
22532868 These results imply that BART contributes to regulating PKCalpha activity through binding to ANX7, thereby affecting the invasiveness of pancreatic cancer cells.
21901094 We identify a subset of BART miRNAs that are restricted to Latency III in normal infection but are up regulated in tumors that express Latency I and II.
21833473 Our results imply that BART increases active RhoA by inhibiting ARL2 function, which in turn inhibits invasiveness of cancer cells.
21665939 overexpression of the amino (N)-terminal region of G3BP, including the binding region for BART mRNA, dominant-negatively inhibits formation of the complex between endogenous G3BP and BART mRNA, and increases the expression of BART.
19368893 Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector.

AA Sequence

MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYI      1 - 70
SLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLS     71 - 140
SGLVVTSLCKSSSLPASQNNLRH                                                   141 - 163
//

Text Mined References (25)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26135619 2015 Epstein-Barr virus-encoded microRNA BART1 induces tumour metastasis by regulating PTEN-dependent pathways in nasopharyngeal carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24899173 2014 MicroRNA miR-BART20-5p stabilizes Epstein-Barr virus latency by directly targeting BZLF1 and BRLF1.
23849777 2013 Mutations in ARL2BP, encoding ADP-ribosylation-factor-like 2 binding protein, cause autosomal-recessive retinitis pigmentosa.
23685147 2013 EBV-miR-BART1 is involved in regulating metabolism-associated genes in nasopharyngeal carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22745590 2012 BART inhibits pancreatic cancer cell invasion by Rac1 inactivation through direct binding to active Rac1.
22532868 2012 BART inhibits pancreatic cancer cell invasion by PKC? inactivation through binding to ANX7.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...