Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.52
PubTator Score 3.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ulcerative colitis 2087 6.11991182235841E-6
acute quadriplegic myopathy 1157 9.68368692249333E-6
medulloblastoma, large-cell 6234 8.78495810645342E-5
adult high grade glioma 2148 1.50223912526613E-4
primitive neuroectodermal tumor 3031 2.30003088672836E-4
atypical teratoid / rhabdoid tumor 4369 8.43489394916641E-4
invasive ductal carcinoma 2950 0.00197599906939387
lung adenocarcinoma 2714 0.00209924573819442
glioblastoma 5572 0.00341358120054967
ovarian cancer 8492 0.00370730281395547
Rheumatoid Arthritis 1171 0.00705848803218982
primary pancreatic ductal adenocarcinoma 1271 0.0162703423139251
pancreatic cancer 2300 0.0188287370044449
group 3 medulloblastoma 2254 0.0276158474242774
Disease Target Count Z-score Confidence
Milk allergy 3 3.386 1.7

Expression

Synonym

Accession Q9Y2X9 A6NF48 B3KMX2 Q5RKW5 Q9NY92
Symbols ZBP-99
ZNP-99

Gene

  Ortholog (6)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GO Component (2)

Gene RIF (2)

PMID Text
24185900 High ZNF281 expression is associated with colon and breast cancer.
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MKIGSGFLSGGGGTGSSGGSGSGGGGSGGGGGGGSSGRRAEMEPTFPQGMVMFNHRLPPVTSFTRPAGSA      1 - 70
APPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAFPSQRTSWGFLQSLVSIKQEKPADPEEQQS     71 - 140
HHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSILHQHVQQQPAQHHRDVLLSSSSRTDDHHGTE    141 - 210
EPKQDTNVKKAKRPKPESQGIKAKRKPSASSKPSLVGDGEGAILSPSQKPHICDHCSAAFRSSYHLRRHV    211 - 280
LIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTC    281 - 350
QQYFSRTDRLLKHRRTCGEVIVKGATSAEPGSSNHTNMGNLAVLSQGNTSSSRRKTKSKSIAIENKEQKT    351 - 420
GKTNESQISNNINMQSYSVEMPTVSSSGGIIGTGIDELQKRVPKLIFKKGSRKNTDKNYLNFVSPLPDIV    421 - 490
GQKSLSGKPSGSLGIVSNNSVETIGLLQSTSGKQGQISSNYDDAMQFSKKRRYLPTASSNSAFSINVGHM    491 - 560
VSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKSGIPDEVLQSILDQYSNKSESQKEDPFNIAE    561 - 630
PRVDLHTSGEHSELVQEENLSPGTQTPSNDKASMLQEYSKYLQQAFEKSTNASFTLGHGFQFVSLSSPLH    631 - 700
NHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLID    701 - 770
SQKNLETSSAFQSSSQKLTSQKEQKNLESSTGFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFK    771 - 840
SGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR                   841 - 895
//

Text Mined References (28)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24185900 2013 SNAIL and miR-34a feed-forward regulation of ZNF281/ZBP99 promotes epithelial-mesenchymal transition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
More...