Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.38
PubTator Score 3.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.013 9.7e-06
adult high grade glioma -1.800 1.5e-04
atypical teratoid / rhabdoid tumor -1.600 8.4e-04
glioblastoma -1.400 3.4e-03
group 3 medulloblastoma 1.200 2.8e-02
invasive ductal carcinoma 1.100 2.0e-03
lung adenocarcinoma 1.190 2.1e-03
medulloblastoma, large-cell -1.400 8.8e-05
ovarian cancer -1.600 2.3e-06
pancreatic cancer 1.200 1.9e-02
primary pancreatic ductal adenocarcinoma 1.567 1.6e-02
primitive neuroectodermal tumor 1.200 2.3e-04
Rheumatoid arthritis 1.600 7.1e-03
ulcerative colitis 1.500 6.1e-06

 GO Component (2)

Gene RIF (3)

AA Sequence

MKIGSGFLSGGGGTGSSGGSGSGGGGSGGGGGGGSSGRRAEMEPTFPQGMVMFNHRLPPVTSFTRPAGSA      1 - 70
APPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAFPSQRTSWGFLQSLVSIKQEKPADPEEQQS     71 - 140
HHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSILHQHVQQQPAQHHRDVLLSSSSRTDDHHGTE    141 - 210
EPKQDTNVKKAKRPKPESQGIKAKRKPSASSKPSLVGDGEGAILSPSQKPHICDHCSAAFRSSYHLRRHV    211 - 280
LIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTC    281 - 350
QQYFSRTDRLLKHRRTCGEVIVKGATSAEPGSSNHTNMGNLAVLSQGNTSSSRRKTKSKSIAIENKEQKT    351 - 420
GKTNESQISNNINMQSYSVEMPTVSSSGGIIGTGIDELQKRVPKLIFKKGSRKNTDKNYLNFVSPLPDIV    421 - 490
GQKSLSGKPSGSLGIVSNNSVETIGLLQSTSGKQGQISSNYDDAMQFSKKRRYLPTASSNSAFSINVGHM    491 - 560
VSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKSGIPDEVLQSILDQYSNKSESQKEDPFNIAE    561 - 630
PRVDLHTSGEHSELVQEENLSPGTQTPSNDKASMLQEYSKYLQQAFEKSTNASFTLGHGFQFVSLSSPLH    631 - 700
NHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLID    701 - 770
SQKNLETSSAFQSSSQKLTSQKEQKNLESSTGFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFK    771 - 840
SGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR                   841 - 895
//

Text Mined References (30)

PMID Year Title