Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.45
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma 1.217 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.011

AA Sequence

MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT      1 - 70
TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21685362 2011 The IDOL-UBE2D complex mediates sterol-dependent degradation of the LDL receptor.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...