Property Summary

NCBI Gene PubMed Count 25
PubMed Score 27.71
PubTator Score 17.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.037 0.000
acute quadriplegic myopathy 1.393 0.000
ovarian cancer 1.500 0.011

Synonym

Accession Q9Y2X3 Q53SA4 Q6PK08 Q9P036 Q9UFN3
Symbols NOP5
HSPC120
NOP5/NOP58

Gene

Gene RIF (4)

PMID Text
22174317 HIV-1 Rev interacting protein, ribonucleoprotein homolog (NOP58), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NOP58 is increased by RRE
20797632 SUMOylation is essential for high-affinity Nop58 binding to small nucleolar riboproteins.
19620283 snoRNP assembly factor NUFIP can regulate the interactions between TIP48 and TIP49 and the core box C/D proteins.
12032086 Mammalian and yeast U3 snoRNPs are matured in specific and related nuclear compartments.

AA Sequence

MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINK      1 - 70
QLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCL     71 - 140
GLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQK    141 - 210
VGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMM    211 - 280
AIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQT    281 - 350
SPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYE    351 - 420
HKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKR    421 - 490
GKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED                                   491 - 529
//

Text Mined References (43)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25074380 2014 Identification of discrete classes of small nucleolar RNA featuring different ends and RNA binding protein dependency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21522132 2011 CRM1 controls the composition of nucleoplasmic pre-snoRNA complexes to licence them for nucleolar transport.
More...