Property Summary

NCBI Gene PubMed Count 25
PubMed Score 29.99
PubTator Score 17.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Target Count P-value
juvenile dermatomyositis 1187 1.9e-10
acute quadriplegic myopathy 1158 2.4e-07
ovarian cancer 8520 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.393 2.4e-07
juvenile dermatomyositis 1.037 1.9e-10
ovarian cancer 1.500 1.1e-02

Gene RIF (4)

AA Sequence

MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINK      1 - 70
QLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCL     71 - 140
GLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQK    141 - 210
VGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMM    211 - 280
AIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQT    281 - 350
SPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYE    351 - 420
HKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKR    421 - 490
GKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED                                   491 - 529
//

Text Mined References (44)

PMID Year Title