Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.04
PubTator Score 8.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Endometriosis 540 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 4.7e-06
psoriasis 6694 2.7e-04
hereditary spastic paraplegia 318 6.3e-04
astrocytoma 1146 3.2e-03
Rheumatoid arthritis 1191 3.5e-03
dermatomyositis 966 1.0e-02
osteosarcoma 7950 3.3e-02
spina bifida 1074 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Bulimia nervosa 14 4.021 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.200 3.2e-03
dermatomyositis 1.100 1.0e-02
hereditary spastic paraplegia 1.579 6.3e-04
osteosarcoma -1.073 3.3e-02
ovarian cancer -1.500 4.7e-06
psoriasis 1.400 2.7e-04
Rheumatoid arthritis 1.300 3.5e-03
spina bifida -1.128 4.9e-02

AA Sequence

MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHP      1 - 70
WDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWESSVGSLVEGDPIVALSWLHNG     71 - 140
VKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLR    141 - 210
GRVALADIAFTGGGNIVVATADGSSASPVQFYKVCVSVVSEKCRIDTEILPSLFMRCTTDLNRKDKFPAI    211 - 280
THLKFLARDMSEQVLLCASSQTSSIVECWSLRKEGLPVNNIFQQISPVVGDKQPTILKWRILSATNDLDR    281 - 350
VSAVALPKLPISLTNTDLKVASDTQFYPGLGLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMK    351 - 420
RPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEYCMVTGYDWWD    421 - 490
ILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTL    491 - 560
KSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLA    561 - 630
SLPNQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICC    631 - 700
RDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGL    701 - 770
ARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLAVEGRGPDACVT    771 - 840
SRASEEAPAFVQLGPQSTHHSPRTPRSLDHLHPEDRP                                     841 - 877
//

Text Mined References (13)

PMID Year Title