Property Summary

NCBI Gene PubMed Count 59
PubMed Score 55.99
PubTator Score 984.13

Knowledge Summary

Patent (1,800)

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.400 2.5e-04
atypical teratoid / rhabdoid tumor -1.300 2.1e-07
glioblastoma -1.200 7.7e-06
group 3 medulloblastoma -1.200 2.6e-03
medulloblastoma, large-cell -1.400 1.2e-04
non-inflammatory breast cancer -1.100 3.4e-03
oligodendroglioma 1.300 9.5e-03

Gene RIF (34)

AA Sequence

MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSDSELELS      1 - 70
TVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDA     71 - 140
DGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDA    141 - 210
PAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI                            211 - 256
//

Text Mined References (63)

PMID Year Title