Property Summary

NCBI Gene PubMed Count 54
PubMed Score 53.32
PubTator Score 984.13

Knowledge Summary

Patent (1,800)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma 1524 7.62763102363033E-8
atypical teratoid / rhabdoid tumor 4369 2.09496222988947E-7
glioblastoma 5572 7.74263606113285E-6
medulloblastoma, large-cell 6234 1.20985881578993E-4
adult high grade glioma 2148 2.46692866914717E-4
non-inflammatory breast cancer 208 0.00342193138794523
oligodendroglioma 2849 0.00954092435058746
Disease Target Count Z-score Confidence
Alzheimer's disease 644 3.461 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.300 0.010
medulloblastoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.400 0.000
adult high grade glioma -1.400 0.000
non-inflammatory breast cancer -1.100 0.003

Synonym

Accession Q9Y2W7 H7BY46 Q3YAC3 Q3YAC4 Q53TJ5 Q96T40 Q9UJ84 Q9UJ85
Symbols CSEN
DREAM
KCHIP3

Gene

PDB

2E6W  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (30)

PMID Text
26384566 downregulation of these genes through the p53-p21-DREAM-CDE/CHR pathway appears to be a principal mechanism for G2/M cell cycle arrest by p53.
26319784 The aim of this study was to investigate somatic mutations and DREAM gene expression in human multinodular goiter
23786773 Imatinib induces GIST cell quiescence in vivo and that this process also involves the DREAM complex.
23692269 Our results support the hypothesis that KChIPs enhances Kv4.2 functional expression by a 1 : 1 suppression of the N-terminal FERN domain and by producing additional positive regulatory effects on functional channel expression.
23300953 GCM1-directed villous trophoblast differentiation is repressed by DREAM
23187802 p53 can repress transcription of cell cycle genes through a p21(WAF1/CIP1)-dependent switch from MMB to DREAM protein complex binding at CHR promoter elements.
23019329 The potassium channel interacting protein 3 (DREAM/KChIP3) heterodimerizes with and regulates calmodulin function.
22730276 Genetic variation in the DREAM pathway genes was associated with the extent of pain reporting in a population-based cohort.
21852538 expression of calsenilin leads to a disruption of presenilin 1/gamma-secretase-mediated epsilon-cleavage of N-cadherin, which results in the significant accumulation of N-cadherin C-terminal fragment 1
21813705 The results show that continued human papillomavirus 16 E6/E7 expression is necessary in cervical cancer cells to prevent cell-cycle arrest by a repressive p130-DREAM complex.
More...

AA Sequence

MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSDSELELS      1 - 70
TVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDA     71 - 140
DGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDA    141 - 210
PAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI                            211 - 256
//

Text Mined References (58)

PMID Year Title
26384566 2016 The p53-p21-DREAM-CDE/CHR pathway regulates G2/M cell cycle genes.
26319784 2015 Evaluation of Downstream Regulatory Element Antagonistic Modulator Gene in Human Multinodular Goiter.
25416956 2014 A proteome-scale map of the human interactome network.
23786773 2013 The DREAM complex mediates GIST cell quiescence and is a novel therapeutic target to enhance imatinib-induced apoptosis.
23692269 2013 Functional stoichiometry underlying KChIP regulation of Kv4.2 functional expression.
23300953 2013 DREAM mediated regulation of GCM1 in the human placental trophoblast.
23187802 2012 p53 can repress transcription of cell cycle genes through a p21(WAF1/CIP1)-dependent switch from MMB to DREAM protein complex binding at CHR promoter elements.
23019329 2012 The potassium channel interacting protein 3 (DREAM/KChIP3) heterodimerizes with and regulates calmodulin function.
22730276 2013 Investigating the role of pain-modulating pathway genes in musculoskeletal pain.
21852538 2011 Calsenilin regulates presenilin 1/?-secretase-mediated N-cadherin ?-cleavage and ?-catenin signaling.
More...