Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.51
PubTator Score 2.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 2.9e-33
lung carcinoma 2843 8.0e-29
Breast cancer 3578 3.2e-06
malignant mesothelioma 3232 8.4e-04
ependymoma 4679 5.0e-03
invasive ductal carcinoma 2951 9.6e-03
astrocytic glioma 2597 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 1.2e-02
Breast cancer 1.100 3.2e-06
breast carcinoma 1.100 2.9e-33
ependymoma -1.100 5.0e-03
invasive ductal carcinoma 1.200 9.6e-03
lung carcinoma 1.400 8.0e-29
malignant mesothelioma 1.600 8.4e-04

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MSTERTSWTSLSTIQKIALGLGIPASATVAYILYRRYRESREERLTFVGEDDIEIEMRVPQEAVKLIIGR      1 - 70
QGANIKQLRKQTGARIDVDTEDVGDERVLLISGFPVQVCKAKAAIHQILTENTPVSEQLSVPQRSVGRII     71 - 140
GRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQKEVAAAKHLILEKVSEDEELRKRIAHSAET    141 - 210
RVPRKQPISVRREDMTEPGGAGEPALWKNTSSSMEPTAPLVTPPPKGGGDMAVVVSKEGSWEKPSDDSFQ    211 - 280
KSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPE    281 - 350
DLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECS    351 - 420
LARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSNGKKLDIGLELVHKG    421 - 490
YAIELPEDIEENRAVPDMLKDMATETDASLSTLLTETKKSSGEITHTLSCLSLSEAASMSGDDNLEDDYL    491 - 560
L//

Text Mined References (13)

PMID Year Title