Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.25
PubTator Score 2.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 2.92597436866106E-33
lung carcinoma 2844 7.97011030221055E-29
malignant mesothelioma 3163 4.28304778756364E-7
Breast cancer 3099 3.17243261126347E-6
ependymoma 2514 0.00495092573726785
invasive ductal carcinoma 2950 0.00959549796718502
astrocytic glioma 2241 0.0116922066133774

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.600 0.000
astrocytic glioma -1.400 0.012
ependymoma -1.100 0.005
lung carcinoma 1.400 0.000
breast carcinoma 1.100 0.000
Breast cancer 1.100 0.000
invasive ductal carcinoma 1.200 0.010

Synonym

Accession Q9Y2W6 D3DV24 Q5SZR3 Q5SZR5 Q8N582 Q9NYV5
Symbols TDRD2

Gene

PANTHER Protein Class (2)

PDB

2DIQ   3FDR   5J39  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
15955813 Tudor domain proteins interact with arginine-glycine-rich motifs in a methylarginine-dependent manner.

AA Sequence

MSTERTSWTSLSTIQKIALGLGIPASATVAYILYRRYRESREERLTFVGEDDIEIEMRVPQEAVKLIIGR      1 - 70
QGANIKQLRKQTGARIDVDTEDVGDERVLLISGFPVQVCKAKAAIHQILTENTPVSEQLSVPQRSVGRII     71 - 140
GRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQKEVAAAKHLILEKVSEDEELRKRIAHSAET    141 - 210
RVPRKQPISVRREDMTEPGGAGEPALWKNTSSSMEPTAPLVTPPPKGGGDMAVVVSKEGSWEKPSDDSFQ    211 - 280
KSEAQAIPEMPMFEIPSPDFSFHADEYLEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPE    281 - 350
DLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECS    351 - 420
LARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSNGKKLDIGLELVHKG    421 - 490
YAIELPEDIEENRAVPDMLKDMATETDASLSTLLTETKKSSGEITHTLSCLSLSEAASMSGDDNLEDDYL    491 - 560
L//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15955813 2005 Tudor domains bind symmetrical dimethylated arginines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...