Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.40
PubTator Score 236.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 7.7e-06
atypical teratoid / rhabdoid tumor -1.100 1.1e-04
ependymoma -1.200 9.7e-03
glioblastoma -1.100 9.1e-07
group 3 medulloblastoma -1.500 7.9e-06
medulloblastoma, large-cell -1.800 2.2e-06
psoriasis -1.200 1.2e-30

Gene RIF (1)

AA Sequence

MLQQPGPRPGRQQPSGDRDACRLHPQGRPPALPTMIPAASSTPPGDALFPSVAPQDFWRSQVTGYSGSVT      1 - 70
RHLSHRANNFKRHPKRRKCIRPSPPPPPNTPCPLELVDFGDLHPQRSFRELLFNGCILFGIEFSYAMETA     71 - 140
YVTPVLLQMGLPDQLYSLVWFISPILGFLLQPLLGAWSDRCTSRFGRRRPFILVLAIGALLGLSLLLNGR    141 - 210
DIGIALADVTGNHKWGLLLTVCGVVLMDFSADSADNPSHAYMMDVCSPADQDRGLNIHALLAGLGGGFGY    211 - 280
VVGGIHWDKTGFGRALGGQLRVIYLFTAVTLSVTTVLTLVSIPERPLRPPSEKRAAMKSPSLPLPPSPPV    281 - 350
LPEEGPGDSLPSHTATNFSSPISPPSPLTPKYGSFISRDSSLTGISEFASSFGTANIDSVLIDCFTGGHD    351 - 420
SYLAIPGSVPRPPISVSFPRAPDGFYRQDRGLLEGREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQT    421 - 490
LAIPDAAGGGGPETSRRRNVTFSQQVANILLNGVKYESELTGSSERAEQPLSVGRLCSTICNMPKALRTL    491 - 560
CVNHFLGWLSFEGMLLFYTDFMGEVVFQGDPKAPHTSEAYQKYNSGVTMGCWGMCIYAFSAAFYSAILEK    561 - 630
LEEFLSVRTLYFIAYLAFGLGTGLATLSRNLYVVLSLCITYGILFSTLCTLPYSLLCDYYQSKKFAGSSA    631 - 700
DGTRRGMGVDISLLSCQYFLAQILVSLVLGPLTSAVGSANGVMYFSSLVSFLGCLYSSLFVIYEIPPSDA    701 - 770
ADEEHRPLLLNV                                                              771 - 782
//

Text Mined References (7)

PMID Year Title