Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.78
PubTator Score 8.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.300 8.5e-04
astrocytic glioma -1.600 8.8e-03
atypical teratoid / rhabdoid tumor -1.800 1.6e-06
ependymoma -1.500 2.6e-02
glioblastoma -1.500 2.8e-04
group 4 medulloblastoma 1.400 8.8e-05
medulloblastoma, large-cell 1.800 2.4e-04
Multiple myeloma 1.113 1.1e-03
oligodendroglioma -1.400 2.0e-02
osteosarcoma -2.174 1.1e-05
ovarian cancer 1.300 1.7e-02
pituitary cancer 1.200 4.9e-04
psoriasis 1.400 8.7e-05
subependymal giant cell astrocytoma -2.278 1.6e-02

Gene RIF (1)

AA Sequence

MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQ      1 - 70
PQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIP     71 - 140
LPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQ    141 - 210
VVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSD    211 - 280
GESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVE    281 - 350
EFSEDDDEDDSDDSEAEKQSQKQHKEESHSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPPLGPPPAPP    351 - 420
LRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPR    421 - 490
LPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNLIQRPKADDTSAATIEKKATA    491 - 560
TISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVY    561 - 630
EAFMKEMEGLL                                                               631 - 641
//

Text Mined References (34)

PMID Year Title