Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.58
PubTator Score 8.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.57164492462359E-6
osteosarcoma 7933 1.06938781791425E-5
psoriasis 6685 8.73568437063791E-5
group 4 medulloblastoma 1875 8.7799439346089E-5
medulloblastoma, large-cell 6234 2.40965897729922E-4
glioblastoma 5572 2.78005211573922E-4
pituitary cancer 1972 4.89520744400921E-4
adult high grade glioma 2148 8.46599596501921E-4
astrocytic glioma 2241 0.00884362099858404
Multiple myeloma 1328 0.0104557113169349
subependymal giant cell astrocytoma 2287 0.0156647603289717
ovarian cancer 8492 0.0172374082328024
oligodendroglioma 2849 0.0198437849097145
ependymoma 2514 0.0259710852408881
Disease Target Count Z-score Confidence
Intellectual disability 573 3.708 1.9

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.156 0.010
astrocytic glioma -1.600 0.009
ependymoma -1.500 0.026
oligodendroglioma -1.400 0.020
psoriasis 1.400 0.000
osteosarcoma -2.174 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.500 0.000
group 4 medulloblastoma 1.400 0.000
medulloblastoma, large-cell 1.800 0.000
adult high grade glioma -1.300 0.001
subependymal giant cell astrocytoma -2.278 0.016
ovarian cancer 1.300 0.017
pituitary cancer 1.200 0.000

Synonym

Accession Q9Y2W2 Q96AY8 WBP-11
Symbols NPWBP
SIPP1
WBP-11
PPP1R165

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
16162498 SIPP1 is a positive regulator of pre-mRNA splicing that is regulated by nucleocytoplasmic shuttling

AA Sequence

MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQ      1 - 70
PQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIP     71 - 140
LPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQ    141 - 210
VVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSD    211 - 280
GESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVE    281 - 350
EFSEDDDEDDSDDSEAEKQSQKQHKEESHSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPPLGPPPAPP    351 - 420
LRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPR    421 - 490
LPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNLIQRPKADDTSAATIEKKATA    491 - 560
TISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVY    561 - 630
EAFMKEMEGLL                                                               631 - 641
//

Text Mined References (31)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24136289 2013 Identification and comparative analysis of hepatitis C virus-host cell protein interactions.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
More...