Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.58
PubTator Score 8.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.156 0.010
astrocytic glioma -1.600 0.009
ependymoma -1.500 0.026
oligodendroglioma -1.400 0.020
psoriasis 1.400 0.000
osteosarcoma -2.174 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.500 0.000
group 4 medulloblastoma 1.400 0.000
medulloblastoma, large-cell 1.800 0.000
adult high grade glioma -1.300 0.001
subependymal giant cell astrocytoma -2.278 0.016
ovarian cancer 1.300 0.017
pituitary cancer 1.200 0.000

Synonym

Accession Q9Y2W2 Q96AY8 WBP-11
Symbols NPWBP
SIPP1
WBP-11
PPP1R165

Gene

Gene RIF (1)

PMID Text
16162498 SIPP1 is a positive regulator of pre-mRNA splicing that is regulated by nucleocytoplasmic shuttling

AA Sequence

MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQ      1 - 70
PQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIP     71 - 140
LPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQ    141 - 210
VVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSD    211 - 280
GESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVE    281 - 350
EFSEDDDEDDSDDSEAEKQSQKQHKEESHSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPPLGPPPAPP    351 - 420
LRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPR    421 - 490
LPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNLIQRPKADDTSAATIEKKATA    491 - 560
TISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVY    561 - 630
EAFMKEMEGLL                                                               631 - 641
//

Text Mined References (31)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24136289 2013 Identification and comparative analysis of hepatitis C virus-host cell protein interactions.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
More...