Property Summary

NCBI Gene PubMed Count 38
Grant Count 9
R01 Count 6
Funding $786,932.7
PubMed Score 7.46
PubTator Score 10.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.132 0.001
ovarian cancer 1.500 0.000

Gene RIF (10)

PMID Text
26261210 The data suggest a model in which TRAP150 interacts with dimeric PSF to block access of RNA to RRM2, thereby regulating the activity of PSF toward a broad set of splicing events in T cells.
25316675 Thrap3 plays a crucial role in controlling diabetic gene programming and may provide opportunities for the development of new therapeutics for obesity and type 2 diabetes.
24055347 Data indicate that distinct differences in proteins becoming Poly(ADP-ribose) PARylated upon various genotoxic insults are observed, exemplified by the PARylation of RNA-processing factors THRAP3 and TAF15 under oxidative stress.
23778535 BTF has functions distinct from TRAP150 in regulating the subcellular distribution of mRNAs in human cells.
23525231 Thrap3 could play indispensable roles in terminal differentiation of adipocytes by enhancing PPARgamma-mediated gene activation cooperatively with Helz2.
22944692 HIV-1 Gag is identified to have a physical interaction with thyroid hormone receptor associated protein 3 (THRAP3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22424773 THRAP3 has a rold in the DNA damage response.
22190034 HIV-1 Gag is identified to have a physical interaction with thyroid hormone receptor associated protein 3 (THRAP3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20016921 HIV-1 Gag is identified to have a physical interaction with thyroid hormone receptor associated protein 3 (THRAP3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12130544 TFIID and human mediator coactivator (TRAP150) complexes assemble cooperatively on promoter DNA

AA Sequence

MSKTNKSKSGSRSSRSRSASRSRSRSFSKSRSRSRSLSRSRKRRLSSRSRSRSYSPAHNRERNHPRVYQN      1 - 70
RDFRGHNRGYRRPYYFRGRNRGFYPWGQYNRGGYGNYRSNWQNYRQAYSPRRGRSRSRSPKRRSPSPRSR     71 - 140
SHSRNSDKSSSDRSRRSSSSRSSSNHSRVESSKRKSAKEKKSSSKDSRPSQAAGDNQGDEAKEQTFSGGT    141 - 210
SQDTKASESSKPWPDATYGTGSASRASAVSELSPRERSPALKSPLQSVVVRRRSPRPSPVPKPSPPLSST    211 - 280
SQMGSTLPSGAGYQSGTHQGQFDHGSGSLSPSKKSPVGKSPPSTGSTYGSSQKEESAASGGAAYTKRYLE    281 - 350
EQKTENGKDKEQKQTNTDKEKIKEKGSFSDTGLGDGKMKSDSFAPKTDSEKPFRGSQSPKRYKLRDDFEK    351 - 420
KMADFHKEEMDDQDKDKAKGRKESEFDDEPKFMSKVIGANKNQEEEKSGKWEGLVYAPPGKEKQRKTEEL    421 - 490
EEESFPERSKKEDRGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSS    491 - 560
FSITREAQVNVRMDSFDEDLARPSGLLAQERKLCRDLVHSNKKEQEFRSIFQHIQSAQSQRSPSELFAQH    561 - 630
IVTIVHHVKEHHFGSSGMTLHERFTKYLKRGTEQEAAKNKKSPEIHRRIDISPSTFRKHGLAHDEMKSPR    631 - 700
EPGYKAEGKYKDDPVDLRLDIERRKKHKERDLKRGKSRESVDSRDSSHSRERSAEKTEKTHKGSKKQKKH    701 - 770
RRARDRSRSSSSSSQSSHSYKAEEYTEETEEREESTTGFDKSRLGTKDFVGPSERGGGRARGTFQFRARG    771 - 840
RGWGRGNYSGNNNNNSNNDFQKRNREEEWDPEYTPKSKKYYLHDDREGEGSDKWVSRGRGRGAFPRGRGR    841 - 910
FMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDNIQPTTE                             911 - 955
//

Text Mined References (60)

PMID Year Title
26261210 2015 TRAP150 interacts with the RNA-binding domain of PSF and antagonizes splicing of numerous PSF-target genes in T cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25316675 2014 Thrap3 docks on phosphoserine 273 of PPAR? and controls diabetic gene programming.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24100041 2013 Identification of Wilms' tumor 1-associating protein complex and its role in alternative splicing and the cell cycle.
24055347 2013 Proteome-wide identification of poly(ADP-Ribosyl)ation targets in different genotoxic stress responses.
More...