Property Summary

NCBI Gene PubMed Count 26
PubMed Score 40.26
PubTator Score 15.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 1.1e-03
glioblastoma -1.100 5.7e-07
hepatocellular carcinoma 1.100 1.7e-04
medulloblastoma, large-cell -1.200 2.7e-03
ovarian cancer -1.100 4.8e-03
primitive neuroectodermal tumor -1.100 1.2e-05

Gene RIF (10)

AA Sequence

MAEGSGEVVAVSATGAANGLNNGAGGTSATTCNPLSRKLHKILETRLDNDKEMLEALKALSTFFVENSLR      1 - 70
TRRNLRGDIERKSLAINEEFVSIFKEVKEELESISEDVQAMSNCCQDMTSRLQAAKEQTQDLIVKTTKLQ     71 - 140
SESQKLEIRAQVADAFLSKFQLTSDEMSLLRGTREGPITEDFFKALGRVKQIHNDVKVLLRTNQQTAGLE    141 - 210
IMEQMALLQETAYERLYRWAQSECRTLTQESCDVSPVLTQAMEALQDRPVLYKYTLDEFGTARRSTVVRG    211 - 280
FIDALTRGGPGGTPRPIEMHSHDPLRYVGDMLAWLHQATASEKEHLEALLKHVTTQGVEENIQEVVGHIT    281 - 350
EGVCRPLKVRIEQVIVAEPGAVLLYKISNLLKFYHHTISGIVGNSATALLTTIEEMHLLSKKIFFNSLSL    351 - 420
HASKLMDKVELPPPDLGPSSALNQTLMLLREVLASHDSSVVPLDARQADFVQVLSCVLDPLLQMCTVSAS    421 - 490
NLGTADMATFMVNSLYMMKTTLALFEFTDRRLEMLQFQIEAHLDTLINEQASYVLTRVGLSYIYNTVQQH    491 - 560
KPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAA    561 - 630
VMNPINEYKDPENILHRSPQQVQTLLS                                               631 - 657
//

Text Mined References (30)

PMID Year Title