Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.68
PubTator Score 44.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MHLPGCAPAMADGSFSLAGHLLRSPGGSTSRLHSIEAILGFTKDDGILGTFPAERGARGAKERDRRLGAR      1 - 70
PACPKAPEEGSEPSPPPAPAPAPEYEAPRPYCPKEPGEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNR     71 - 140
TTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQDSPLL    141 - 210
SFSRSPPSATLSPLGAGPGSGGGPAGGALPLESWLGPPLPGGGATALQSLPGFGPPAQSLPASYTPPPPP    211 - 280
PPFLNSPPLGPGLQPLAPPPPSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQAIGKPWQAL        281 - 346
//

Text Mined References (16)

PMID Year Title