Property Summary

NCBI Gene PubMed Count 7
PubMed Score 669.47
PubTator Score 12.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.087 2.2e-02
ovarian cancer -2.000 1.0e-06
pancreatic ductal adenocarcinoma liver m... -2.100 1.5e-02
Pick disease -1.100 3.8e-04

Synonym

Accession Q9Y2U9 B3KPF9 Q6IAF0 Q86TY9
Symbols LCP
HCLP1
HCLP-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MADGNEDLRADDLPGPAFESYESMELACPAERSGHVAVSDGRHMFVWGGYKSNQVRGLYDFYLPREELWI      1 - 70
YNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYMLDSRSTDRVLQWERIDCQGI     71 - 140
PPSSKDKLGVWVYKNKLIFFGGYGYLPEDKVLGTFEFDETSFWNSSHPRGWNDHVHILDTETFTWSQPIT    141 - 210
TGKAPSPRAAHACATVGNRGFVFGGRYRDARMNDLHYLNLDTWEWNELIPQGICPVGRSWHSLTPVSSDH    211 - 280
LFLFGGFTTDKQPLSDAWTYCISKNEWIQFNHPYTEKPRLWHTACASDEGEVIVFGGCANNLLVHHRAAH    281 - 350
SNEILIFSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS                  351 - 406
//

Text Mined References (8)

PMID Year Title