Property Summary

NCBI Gene PubMed Count 7
Grant Count 84
R01 Count 27
Funding $37,342,417.64
PubMed Score 612.35
PubTator Score 12.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.087 0.022
pancreatic ductal adenocarcinoma liver m... -2.100 0.015
Pick disease -1.100 0.000
ovarian cancer -2.000 0.000

Synonym

Accession Q9Y2U9 B3KPF9 Q6IAF0 Q86TY9
Symbols LCP
HCLP1
HCLP-1

Gene

Gene RIF (2)

PMID Text
18187620 Knockdown of kelch domain containing 2 (KLHDC2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16964437 Data show that KLHDC1 and KLHDC2 have differential localization and activity in cultured mammalian cells.

AA Sequence

MADGNEDLRADDLPGPAFESYESMELACPAERSGHVAVSDGRHMFVWGGYKSNQVRGLYDFYLPREELWI      1 - 70
YNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYMLDSRSTDRVLQWERIDCQGI     71 - 140
PPSSKDKLGVWVYKNKLIFFGGYGYLPEDKVLGTFEFDETSFWNSSHPRGWNDHVHILDTETFTWSQPIT    141 - 210
TGKAPSPRAAHACATVGNRGFVFGGRYRDARMNDLHYLNLDTWEWNELIPQGICPVGRSWHSLTPVSSDH    211 - 280
LFLFGGFTTDKQPLSDAWTYCISKNEWIQFNHPYTEKPRLWHTACASDEGEVIVFGGCANNLLVHHRAAH    281 - 350
SNEILIFSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS                  351 - 406
//

Text Mined References (8)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964437 2007 Differential subcellular localization and activity of kelch repeat proteins KLHDC1 and KLHDC2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
11384994 2001 Inhibition of LZIP-mediated transcription through direct interaction with a novel host cell factor-like protein.