Property Summary

NCBI Gene PubMed Count 39
Grant Count 42
R01 Count 17
Funding $2,106,510.16
PubMed Score 25.51
PubTator Score 35.61

Knowledge Summary

Patent (4,804)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (19)

PMID Text
25382779 SMYD3-mediated methylation of MAP3K2 increases mutant K-Ras-induced activation of ERK1/2. (Review)
25304384 HBXIP activated ERK1/2 through up-regulating MEKK2.
25190348 MEKK2 has a novel function as a regulator of ubiquitylation-dependent paxillin redistribution in breast tumour cells.
25012295 EBV microRNA BART 18-5p targets MAP3K2 to facilitate persistence in vivo by inhibiting viral replication in B cells.
24975362 Inhibitors of apoptosis proteins regulate myogenic differentiation by directly suppressing MEKK2/3-MEK5-ERK5 signaling.
24847881 methylation of MAP3K2 by SMYD3 increases MAP kinase signalling and promotes the formation of Ras-driven carcinomas
24801835 Restoration of miR17/20a in solid tumor cells enhances the natural killer cell antitumor activity by targeting Mekk2
24491810 results strongly support a role for MEKK2 as a regulator of signaling that modulates breast tumor cell spread area and migration through control of focal adhesion stability
22139075 Data suggest that MEKK2 and MLK3 represent untargeted kinases in tumor biology for potential therapeutic development.
21804577 Hepatitis B virus X protein enhances the growth of hepatoma cells through upregulation of MEKK2.
More...

AA Sequence

MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRS      1 - 70
KAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLD     71 - 140
NTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMDQMLDPLSLSSPE    141 - 210
NSGSGSCPSLDSPLDGESYPKSRMPRAQSYPDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDG    211 - 280
RKTFPRARRTQGTSLRSPVSFSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSP    281 - 350
RAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ    351 - 420
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANIL    421 - 490
RDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPP    491 - 560
WAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSADELLRHMFVHYH               561 - 619
//

Text Mined References (52)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25382779 2014 Lysine methylation in cancer: SMYD3-MAP3K2 teaches us new lessons in the Ras-ERK pathway.
25304384 2014 The oncoprotein HBXIP enhances migration of breast cancer cells through increasing filopodia formation involving MEKK2/ERK1/2/Capn4 signaling.
25190348 2014 MEKK2 regulates paxillin ubiquitylation and localization in MDA-MB 231 breast cancer cells.
25012295 2014 EBV microRNA BART 18-5p targets MAP3K2 to facilitate persistence in vivo by inhibiting viral replication in B cells.
24975362 2014 Ubiquitin-dependent regulation of MEKK2/3-MEK5-ERK5 signaling module by XIAP and cIAP1.
24847881 2014 SMYD3 links lysine methylation of MAP3K2 to Ras-driven cancer.
24801835 2014 Restoration of miR17/20a in solid tumor cells enhances the natural killer cell antitumor activity by targeting Mekk2.
24491810 2014 MEKK2 regulates focal adhesion stability and motility in invasive breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...