Property Summary

Ligand Count 5
NCBI Gene PubMed Count 42
PubMed Score 26.55
PubTator Score 35.61

Knowledge Summary

Patent (4,804)

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia 2.200 2.7e-02
acute quadriplegic myopathy 1.124 1.9e-05
astrocytic glioma 1.100 2.8e-02
atypical teratoid / rhabdoid tumor 1.400 7.1e-05
diabetes mellitus -1.500 2.2e-03
ependymoma 1.200 1.8e-04
glioblastoma 1.400 3.3e-03
group 4 medulloblastoma 1.800 4.3e-04
intraductal papillary-mucinous adenoma (... 1.300 4.3e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.6e-02
juvenile dermatomyositis 1.085 3.1e-09
medulloblastoma, large-cell 1.700 4.3e-05
osteosarcoma 2.038 1.1e-04
ovarian cancer -1.500 1.8e-05
pancreatic cancer 1.400 1.1e-03
pediatric high grade glioma 1.100 9.0e-05
Pick disease 1.200 2.8e-06
primary pancreatic ductal adenocarcinoma 1.564 1.2e-03
primitive neuroectodermal tumor 1.200 3.5e-05
Rheumatoid arthritis 1.200 1.2e-02
tuberculosis -1.200 2.1e-07

Gene RIF (21)

AA Sequence

MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRS      1 - 70
KAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLD     71 - 140
NTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMDQMLDPLSLSSPE    141 - 210
NSGSGSCPSLDSPLDGESYPKSRMPRAQSYPDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDG    211 - 280
RKTFPRARRTQGTSLRSPVSFSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSP    281 - 350
RAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ    351 - 420
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANIL    421 - 490
RDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPP    491 - 560
WAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSADELLRHMFVHYH               561 - 619
//

Text Mined References (55)

PMID Year Title