Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.17
PubTator Score 2.04

Knowledge Summary

Patent (1,498)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
cutaneous lupus erythematosus 1,056

Expression

  Differential Expression (1)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 0.009

AA Sequence

MGGLRPWSRYGLLVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTA      1 - 70
LATQAHGVSTLGNSSEGRTWDLPSALLFAASILTTTGYGHMAPLSPGGKAFCMVYAALGLPASLALVATL     71 - 140
RHCLLPVLSRPRAWVAVHWQLSPARAALLQAVALGLLVASSFVLLPALVLWGLQGDCSLLGAVYFCFSSL    141 - 210
STIGLEDLLPGRGRSLHPVIYHLGQLALLGYLLLGLLAMLLAVETFSELPQVRAMGKFFRPSGPVTAEDQ    211 - 280
GGILGQDELALSTLPPAAPASGQAPAC                                               281 - 307
//

Text Mined References (7)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
16382106 2005 International Union of Pharmacology. LV. Nomenclature and molecular relationships of two-P potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256078 2001 Potassium leak channels and the KCNK family of two-P-domain subunits.
11165377 2001 Distribution analysis of human two pore domain potassium channels in tissues of the central nervous system and periphery.
10206991 1999 Cloning of a new mouse two-P domain channel subunit and a human homologue with a unique pore structure.