Property Summary

NCBI Gene PubMed Count 14
PubMed Score 94.83
PubTator Score 28.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
active ulcerative colitis -1.431 2.2e-02
cutaneous lupus erythematosus -2.300 3.5e-03
osteosarcoma -1.410 7.7e-04
psoriasis -2.800 7.1e-05

Synonym

Accession Q9Y2T7 D3DTP1 Q8N4P0
Symbols DBPC
MSY2
CSDA3
CONTRIN

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPA      1 - 70
TAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGD     71 - 140
GETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKG    141 - 210
ERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPR    211 - 280
YRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETS    281 - 350
APVNSGDPTTTILE                                                            351 - 364
//

Text Mined References (14)

PMID Year Title