Property Summary

NCBI Gene PubMed Count 12
Grant Count 72
R01 Count 11
Funding $33,854,746.35
PubMed Score 88.22
PubTator Score 28.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -2.300 0.003
psoriasis -2.800 0.000
osteosarcoma -1.410 0.001
active ulcerative colitis -1.431 0.022

Synonym

Accession Q9Y2T7 D3DTP1 Q8N4P0
Symbols DBPC
MSY2
CSDA3
CONTRIN

Gene

Gene RIF (7)

PMID Text
20378615 Observational study of gene-disease association. (HuGE Navigator)
18372033 some polymorphisms of the MSY2 gene might be associated with impaired spermatogenesis and that the gene could also be involved in modifying the susceptibility to idiopathic spermatogenic impairment in humans
18372033 Observational study of gene-disease association. (HuGE Navigator)
18339382 A significant association between gene alterations in the YBX2 gene and abnormal spermatogenesis in humans, including a potential role in altering protamine expression, and implicate YBX2 gene alterations as a potential cause of male factor infertility.
18339382 Observational study of gene-disease association. (HuGE Navigator)
16624424 transcriptional regulation of Contrin was investigated, and the promoter region between -272 and -253 relative to the transcription start site was shown to be critical for the manifestation of cell-type specific transcription
16479255 provides first evidence showing dbpC highly expressed in human testicular seminoma and ovarian dysgerminomas, and in carcinomas in other tissues and that its expression in normal tissues is nearly restricted to germ cells and placental trophoblasts

AA Sequence

MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPA      1 - 70
TAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGD     71 - 140
GETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKG    141 - 210
ERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPR    211 - 280
YRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETS    281 - 350
APVNSGDPTTTILE                                                            351 - 364
//

Text Mined References (12)

PMID Year Title
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
18372033 2008 Some single nucleotide polymorphisms of MSY2 gene might contribute to susceptibility to spermatogenic impairment in idiopathic infertile men.
18339382 2009 Sequence alterations in the YBX2 gene are associated with male factor infertility.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16624424 Expression and cellular localization of dbpC/Contrin in germ cell tumor cell lines.
16479255 2006 Expression of Y-box-binding protein dbpC/contrin, a potentially new cancer/testis antigen.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...