Property Summary

NCBI Gene PubMed Count 99
Grant Count 54
R01 Count 23
Funding $4,675,878.1
PubMed Score 135.74
PubTator Score 127.89

Knowledge Summary

Patent (3,635)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.212 0.000

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1961 confirmatory 140 / 342 / 291661 Image-based HTS for Selective Agonists of GPR55
1965 summary 3 / 0 / 0 Summary of Image-based HTS for Selective Agonists of GPR55
2013 confirmatory 370 / 269 / 291178 Image-Based HTS for Selective Antagonists for GPR55
2026 summary 3 / 0 / 0 Summary of Image-based HTS for Selective Antagonists of GPR55
2079 summary 3 / 0 / 0 Summary of Image-based HTS for Selective Antagonists of GPR35
2347 confirmatory 20 / 0 / 1 SAR analysis of selective Agonists of GPR55 using an Image-Based Assay
2397 confirmatory 6 / 0 / 54 SAR Analysis of Selective Antagonists of GPR55 using an Image-Based Assay
2820 confirmatory 38 / 0 / 0 SAR Analysis of Selective Antagonists of GPR55 using an Image-Based Assay - Set 2
2843 confirmatory 16 / 0 / 23 SAR analysis of selective Agonists of GPR55 using an Image-Based Assay - Set 2
463192 other 9 / 0 / 0 SAR Analysis for the identification of Selective Agonists of GPR55 using an Image-Based Screen
More...

Gene RIF (42)

PMID Text
26436760 GPR55 is involved in the migratory behaviour of colon carcinoma cells.
25989290 Inhibiting the pro-angiogenic L-alpha-lysophosphatidylinositol /GPR55 pathway appears a promising target against angiogenesis in ovarian carcinoma
25970609 GPR55 could play deleterious role in ox-LDL-induced foam cells and could be a novel pharmacological target to manage atherosclerosis and other related cardiovascular diseases.
25889562 GPR55 was a direct target gene of miR-675-5p.
25869640 GPR55 is expressed in placenta,located solely at the placental endothelium; L-alpha-lysophosphatidylinositol (LPI), the endogenous ligand of GPR55, increases migratory activity of venous but not arterial placental endothelial cells suggesting a role of LPI-GPR55 axis in placental venous endothelium function
25545857 expression of CB1 and GPR55 in proximal tubules is altered in response to elevated levels of glucose and albumin
25344934 proinflammatory role in innate immunity
25233417 Data suggest GPR55 (G-protein coupled receptor 55), ABCC1 (ATP-binding cassette sub-family C), and MPR1/ABCB1 (multidrug resistance protein 1) participate/cooperate in autocrine communication/tumorigenesis involving lysophosphatidylinositol. [REVIEW]
25048571 Heteromerization of GPR55 and cannabinoid CB2 receptors modulates signalling
24972076 This review summarizes our current knowledge of expression and function of GPR55 in tissues involved in metabolic regulation and the signaling cascades through which GPR55 is reported to act.
More...

AA Sequence

MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFD      1 - 70
LLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFG     71 - 140
ICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLG    141 - 210
RRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVN    211 - 280
CCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG                                   281 - 319
//

Text Mined References (99)

PMID Year Title
27215467 2016 GPR55: Metabolic Help or Hindrance?
27109575 2016 Advances Towards The Discovery of GPR55 Ligands.
26436760 2016 GPR55 promotes migration and adhesion of colon cancer cells indicating a role in metastasis.
25989290 2015 The GPR 55 agonist, L-?-lysophosphatidylinositol, mediates ovarian carcinoma cell-induced angiogenesis.
25970609 2015 Activation of GPR55 Receptors Exacerbates oxLDL-Induced Lipid Accumulation and Inflammatory Responses, while Reducing Cholesterol Efflux from Human Macrophages.
25889562 2015 Down-regulation of miR-675-5p contributes to tumor progression and development by targeting pro-tumorigenic GPR55 in non-small cell lung cancer.
25869640 2015 A role for GPR55 in human placental venous endothelial cells.
25545857 2015 Elevated cannabinoid receptor 1 and G protein-coupled receptor 55 expression in proximal tubule cells and whole kidney exposed to diabetic conditions.
25344934 2015 The differential characterization of GPR55 receptor in human peripheral blood reveals a distinctive expression in monocytes and NK cells and a proinflammatory role in these innate cells.
25233417 2014 Lysophosphatidylinositol: a novel link between ABC transporters and G-protein-coupled receptors.
More...