Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $19,000
PubMed Score 2.92
PubTator Score 1.49

Knowledge Summary

Patent (1,781)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.047 0.001
atypical teratoid / rhabdoid tumor 1.700 0.001
glioblastoma 1.500 0.001
medulloblastoma 1.200 0.029
medulloblastoma, large-cell 2.400 0.000
adult high grade glioma 1.600 0.002
ovarian cancer 1.900 0.000

Synonym

Accession Q9Y2T5 O75654 Q4VBL6 Q6ISM0
Symbols

Gene

PANTHER Protein Class (2)

 Grant Application (1)

  TechDev Info (2)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available

Gene RIF (2)

PMID Text
25738228 Data show that G protein-coupled receptor 52 (Gpr52) modulates huntingtin protein (Htt) levels in the striatal cells in vitro and in vivo.
23333304 HIV-1 Vif downregulates the expression of G protein-coupled receptor 52 (GPR52) in Vif-expression T cells

AA Sequence

MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLTVIFVFHCAPL      1 - 70
LHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGVHESLTCQVFGYIISVLKSVSMACLACISVDRY     71 - 140
LAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCATSWLTSAYFTGFIVCL    141 - 210
LYAPAAFVVCFTYFHIFKICRQHTKEINDRRARFPSHEVDSSRETGHSPDRRYAMVLFRITSVFYMLWLP    211 - 280
YIIYFLLESSRVLDNPTLSFLTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDQEAQEP    281 - 350
KPRKRANSCSI                                                               351 - 361
//

Text Mined References (6)

PMID Year Title
25738228 2015 A striatal-enriched intronic GPCR modulates huntingtin levels and toxicity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9931487 1999 Identification and cloning of three novel human G protein-coupled receptor genes GPR52, PsiGPR53 and GPR55: GPR55 is extensively expressed in human brain.