Property Summary

NCBI Gene PubMed Count 25
PubMed Score 12.93
PubTator Score 12.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.500 1.1e-03
astrocytic glioma -2.600 5.7e-03
Astrocytoma, Pilocytic -1.800 5.9e-07
Atopic dermatitis 1.100 1.2e-02
atypical teratoid / rhabdoid tumor -2.600 2.0e-08
Breast cancer 1.300 3.3e-05
breast carcinoma 1.200 2.9e-19
ductal carcinoma in situ 1.700 3.4e-02
ependymoma -1.600 4.7e-02
glioblastoma -1.500 6.0e-08
group 3 medulloblastoma -1.500 8.9e-03
intraductal papillary-mucinous adenoma (... 1.500 2.8e-02
intraductal papillary-mucinous neoplasm ... 1.700 1.7e-02
invasive ductal carcinoma 1.500 2.7e-02
lung carcinoma 2.600 1.2e-42
medulloblastoma, large-cell -2.600 2.8e-04
non-small cell lung cancer 1.172 6.7e-07
oligodendroglioma -1.700 3.1e-02
Pick disease -1.200 1.5e-03
primitive neuroectodermal tumor -1.300 6.8e-03
psoriasis 1.100 7.2e-11
spina bifida -2.132 3.2e-02
subependymal giant cell astrocytoma -2.775 4.0e-02

Synonym

Accession Q9Y2T4 A8MSY7 B7Z3Y1 Q7Z4V7 Q8NEC4 Q9H3G7
Symbols PR52
PR55G
IMYPNO
IMYPNO1
B55gamma
B55-GAMMA

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (22)

AA Sequence

MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY      1 - 70
STFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLK     71 - 140
DLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNI    141 - 210
VDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEI    211 - 280
ISSVSDVKFSHSGRYMLTRDYLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSD    281 - 350
SVIMTGAYNNFFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW    351 - 420
HPAENIIAIAATNNLYIFQDKVNSDMH                                               421 - 447
//

Text Mined References (27)

PMID Year Title