Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
Funding $167,951.71
PubMed Score 11.31
PubTator Score 12.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession Q9Y2T4 A8MSY7 B7Z3Y1 Q7Z4V7 Q8NEC4 Q9H3G7
Symbols PR52
PR55G
IMYPNO
IMYPNO1
B55-GAMMA

Gene

Gene RIF (24)

PMID Text
24126060 PPP2R2C is a potential tumor suppressor gene in human brain cancers.
23493267 These findings provide insights into mechanisms by which prostate cancers resist AR-pathway suppression and support inhibiting PPP2R2C complexes.
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22664926 evidence suggests that allelic variation in PPP2R2C may be associated with a variety of personality traits and ADHD per se.
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
20601260 encoding a subunit of proteinphosphatase 2A with a unique expression pattern in brain and a role in synaptic plasticity
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308991 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY      1 - 70
STFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLK     71 - 140
DLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNI    141 - 210
VDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEI    211 - 280
ISSVSDVKFSHSGRYMLTRDYLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSD    281 - 350
SVIMTGAYNNFFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW    351 - 420
HPAENIIAIAATNNLYIFQDKVNSDMH                                               421 - 447
//

Text Mined References (24)

PMID Year Title
24126060 2013 Over expression of PPP2R2C inhibits human glioma cells growth through the suppression of mTOR pathway.
23493267 2013 PPP2R2C loss promotes castration-resistance and is associated with increased prostate cancer-specific mortality.
22664926 2012 PPP2R2C as a candidate gene of a temperament and character trait-based endophenotype of ADHD.
20601260 PPP2R2C, a gene disrupted in autosomal dominant intellectual disability.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308991 2011 Integrative genome-wide association analysis of cytoarchitectural abnormalities in the prefrontal cortex of psychiatric disorders.
19734900 2009 Genetic variant near IRS1 is associated with type 2 diabetes, insulin resistance and hyperinsulinemia.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18069897 2007 A RNA interference screen identifies the protein phosphatase 2A subunit PR55gamma as a stress-sensitive inhibitor of c-SRC.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...