Property Summary

NCBI Gene PubMed Count 18
PubMed Score 32.33
PubTator Score 703.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Alzheimer's disease -1.100 4.6e-02
active ulcerative colitis 1.030 3.2e-02
astrocytic glioma -3.500 4.4e-03
Astrocytoma, Pilocytic -3.800 1.6e-03
atypical teratoid / rhabdoid tumor -4.900 3.2e-06
ependymoma -3.700 2.9e-02
gastric carcinoma 1.600 2.3e-02
glioblastoma -3.000 9.2e-04
group 4 medulloblastoma -4.100 1.0e-02
head and neck cancer and chronic obstruc... -1.600 3.6e-03
interstitial cystitis -3.100 3.9e-03
intraductal papillary-mucinous neoplasm ... 3.000 1.7e-02
medulloblastoma, large-cell -5.700 2.6e-03
nasopharyngeal carcinoma -2.600 5.2e-08
non-small cell lung cancer 1.775 3.3e-08
oligodendroglioma -3.000 1.4e-02
pancreatic cancer 1.100 1.7e-02
pediatric high grade glioma -2.900 1.3e-02
Pick disease -2.400 2.7e-03
pituitary cancer -1.800 3.8e-02
primary pancreatic ductal adenocarcinoma 1.938 2.9e-03
primitive neuroectodermal tumor -5.300 1.7e-03
psoriasis 1.300 7.5e-34

Synonym

Accession Q9Y2T3 B4DTY5 Q5SZC7 Q9H335 Q9ULG2 Guanase
Symbols GAH
CYPIN
GUANASE
NEDASIN

Gene

GDA

PANTHER Protein Class (2)

PDB

2UZ9   3E0L   4AQL  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSH      1 - 70
HEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTAC     71 - 140
YFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKETERFVSEMLQKNYSRVKPIV    141 - 210
TPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHG    211 - 280
CYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVS    281 - 350
NILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI    351 - 420
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV                                        421 - 454
//

Text Mined References (23)

PMID Year Title