Property Summary

NCBI Gene PubMed Count 18
PubMed Score 32.33
PubTator Score 703.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Alzheimer's disease -1.100 4.6e-02
active ulcerative colitis 1.030 3.2e-02
astrocytic glioma -3.500 4.4e-03
Astrocytoma, Pilocytic -3.800 1.6e-03
atypical teratoid / rhabdoid tumor -4.900 3.2e-06
ependymoma -3.700 2.9e-02
gastric carcinoma 1.600 2.3e-02
glioblastoma -3.000 9.2e-04
group 4 medulloblastoma -4.100 1.0e-02
head and neck cancer and chronic obstruc... -1.600 3.6e-03
interstitial cystitis -3.100 3.9e-03
intraductal papillary-mucinous neoplasm ... 3.000 1.7e-02
medulloblastoma, large-cell -5.700 2.6e-03
nasopharyngeal carcinoma -2.600 5.2e-08
non-small cell lung cancer 1.775 3.3e-08
oligodendroglioma -3.000 1.4e-02
pancreatic cancer 1.100 1.7e-02
pediatric high grade glioma -2.900 1.3e-02
Pick disease -2.400 2.7e-03
pituitary cancer -1.800 3.8e-02
primary pancreatic ductal adenocarcinoma 1.938 2.9e-03
primitive neuroectodermal tumor -5.300 1.7e-03
psoriasis 1.300 7.5e-34

Gene RIF (4)

AA Sequence

MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSH      1 - 70
HEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTAC     71 - 140
YFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKETERFVSEMLQKNYSRVKPIV    141 - 210
TPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHG    211 - 280
CYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVS    281 - 350
NILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI    351 - 420
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV                                        421 - 454
//

Text Mined References (23)

PMID Year Title