Property Summary

NCBI Gene PubMed Count 18
Grant Count 39
R01 Count 9
Funding $8,451,770.31
PubMed Score 29.54
PubTator Score 703.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16953063 since the histochemical staining of guanase and immunohistochemical staining of nedasin overlapped in many regions, guanase is presumed to be involved in signal transduction in organs similar to nedasin
16953061 the experiments on guanase and nedasin in rat organs performed in this study are considered to have important implications in the investigation of their physiological significance

AA Sequence

MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSH      1 - 70
HEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTAC     71 - 140
YFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKETERFVSEMLQKNYSRVKPIV    141 - 210
TPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHG    211 - 280
CYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVS    281 - 350
NILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI    351 - 420
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV                                        421 - 454
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16953063 2006 Histochemical and immunohistochemical investigation of guanase and nedasin in human tissues.
16953061 2006 A histochemical and immunohistochemical investigation of guanase and nedasin in rat and human tissues.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...