Property Summary

NCBI Gene PubMed Count 18
PubMed Score 29.54
PubTator Score 703.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 6.83936514922956E-304
oligodendroglioma 2849 1.27218248205885E-19
non-small cell lung cancer 2798 3.27080028078786E-8
nasopharyngeal carcinoma 1056 5.19785829764723E-8
medulloblastoma 1524 2.6859886637096E-7
atypical teratoid / rhabdoid tumor 4369 3.2287487688273E-6
interstitial cystitis 2299 7.25626556721713E-5
glioblastoma 5572 2.12314656387847E-4
primitive neuroectodermal tumor 3031 0.00165656103146073
pilocytic astrocytoma 3086 0.00171156903528915
medulloblastoma, large-cell 6234 0.0025697076970452
Pick disease 1893 0.00266700319924364
primary pancreatic ductal adenocarcinoma 1271 0.00287198965275474
head and neck cancer and chronic obstructive pulmonary disease 237 0.00362876795606253
astrocytic glioma 2241 0.0043961817648216
pediatric high grade glioma 2712 0.012748088638673
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0168323213889487
gastric carcinoma 832 0.0225245695932743
pancreatic cancer 2300 0.0288559029038938
ependymoma 2514 0.0290476292786819
active ulcerative colitis 477 0.0319180344736111
pituitary cancer 1972 0.0380434169499471
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Mental depression 58 0.0 1.0

Expression

Synonym

Accession Q9Y2T3 B4DTY5 Q5SZC7 Q9H335 Q9ULG2 Guanase
Symbols CYPIN
GUANASE
NEDASIN

Gene

GDA

PANTHER Protein Class (1)

PDB

2UZ9   3E0L   4AQL  

  Ortholog (15)

Gene RIF (4)

PMID Text
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16953063 since the histochemical staining of guanase and immunohistochemical staining of nedasin overlapped in many regions, guanase is presumed to be involved in signal transduction in organs similar to nedasin
16953061 the experiments on guanase and nedasin in rat organs performed in this study are considered to have important implications in the investigation of their physiological significance

AA Sequence

MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSH      1 - 70
HEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTAC     71 - 140
YFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKETERFVSEMLQKNYSRVKPIV    141 - 210
TPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHG    211 - 280
CYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVS    281 - 350
NILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI    351 - 420
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV                                        421 - 454
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16953063 2006 Histochemical and immunohistochemical investigation of guanase and nedasin in human tissues.
16953061 2006 A histochemical and immunohistochemical investigation of guanase and nedasin in rat and human tissues.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...