Property Summary

NCBI Gene PubMed Count 26
PubMed Score 0.83
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.8e-07
ependymoma 1.100 1.1e-10
glioblastoma 1.100 9.6e-06
group 3 medulloblastoma 1.200 3.1e-03
medulloblastoma, large-cell 1.100 8.7e-05
ovarian cancer -1.500 1.2e-05
pediatric high grade glioma 1.100 3.2e-06
primitive neuroectodermal tumor 1.200 1.1e-05

Gene RIF (15)

AA Sequence

MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVI      1 - 70
QTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTIL     71 - 140
RSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACI    141 - 210
KLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSI    211 - 280
SFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQK    281 - 350
LPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT      351 - 418
//

Text Mined References (28)

PMID Year Title