Property Summary

NCBI Gene PubMed Count 26
PubMed Score 0.58
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q9Y2T2 Q5JQ12 Q9H5L2
Symbols

Gene

 GO Function (1)

Gene RIF (17)

PMID Text
23404500 Structural basis for the recognition of tyrosine-based sorting signals by the mu3A subunit of the AP-3 adaptor complex
23305486 In the absence of Vpu, Env accumulates extensively within clathrin-coated endosomal structures, including the viral proteins Gag and MA; the tetraspanins CD63 and CD81; the adaptor protein complex AP-3; and AIP1/ALIX, a cellular cofactor for viral budding
22875976 results demonstrate that the intact and stable AP-3 complex is required for HIV-1 assembly and release, and the involvement of the AP-3 complex in late stages of the HIV-1 replication cycle is independent of clathrin-mediated endocytosis
22875976 In the absence of Vpu, Env accumulates extensively within clathrin-coated endosomal structures, including the viral proteins Gag and MA; the tetraspanins CD63 and CD81; the adaptor protein complex AP-3; and AIP1/ALIX, a cellular cofactor for viral budding
22833563 Data indicate that AP-3 facilitates PAR1 interaction with ALIX.
22103831 In the absence of Vpu, Env accumulates extensively within clathrin-coated endosomal structures, including the viral proteins Gag and MA; the tetraspanins CD63 and CD81; the adaptor protein complex AP-3; and AIP1/ALIX, a cellular cofactor for viral budding
20594957 In the absence of Vpu, Env accumulates extensively within clathrin-coated endosomal structures, including the viral proteins Gag and MA; the tetraspanins CD63 and CD81; the adaptor protein complex AP-3; and AIP1/ALIX, a cellular cofactor for viral budding
20012524 In the absence of Vpu, Env accumulates extensively within clathrin-coated endosomal structures, including the viral proteins Gag and MA; the tetraspanins CD63 and CD81; the adaptor protein complex AP-3; and AIP1/ALIX, a cellular cofactor for viral budding
19481122 The present results suggest that AP3 complex genes might not play a major role in the pathogenesis of schizophrenia.
19481122 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVI      1 - 70
QTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTIL     71 - 140
RSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACI    141 - 210
KLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSI    211 - 280
SFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQK    281 - 350
LPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT      351 - 418
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24901711 2014 Adaptor protein complexes AP-1 and AP-3 are required by the HHV-7 Immunoevasin U21 for rerouting of class I MHC molecules to the lysosomal compartment.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
23404500 2013 Structural basis for the recognition of tyrosine-based sorting signals by the ?3A subunit of the AP-3 adaptor complex.
22875976 2012 Defective HIV-1 particle assembly in AP-3-deficient cells derived from patients with Hermansky-Pudlak syndrome type 2.
22833563 2012 AP-3 regulates PAR1 ubiquitin-independent MVB/lysosomal sorting via an ALIX-mediated pathway.
22511774 2012 BLOC-2, AP-3, and AP-1 proteins function in concert with Rab38 and Rab32 proteins to mediate protein trafficking to lysosome-related organelles.
21269460 2011 Initial characterization of the human central proteome.
19481122 2009 Association analysis between schizophrenia and the AP-3 complex genes.
19116314 2009 Localization to mature melanosomes by virtue of cytoplasmic dileucine motifs is required for human OCA2 function.
More...