Property Summary

NCBI Gene PubMed Count 95
Grant Count 88
R01 Count 55
Funding $8,680,415.01
PubMed Score 219.70
PubTator Score 149.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 2.200 0.048
osteosarcoma 1.232 0.040
atypical teratoid / rhabdoid tumor 1.100 0.028
tuberculosis and treatment for 6 months 1.100 0.002
breast carcinoma -1.300 0.000
interstitial cystitis -1.700 0.000
subependymal giant cell astrocytoma -1.455 0.011
lung adenocarcinoma -1.900 0.000
invasive ductal carcinoma -1.800 0.015
ovarian cancer -2.300 0.000

Synonym

Accession Q9Y2T1 Q3MJ88 Q9H3M6 Q9UH84
Symbols AXIL
ODCRCS

Gene

PANTHER Protein Class (2)

Gene RIF (81)

PMID Text
26771938 Low AXIN2 was independently associated with more aggressive Prostate cancer , biochemical recurrence, and metastasis-free survival after Prostatectomies .
26648507 Flow cytometrically sorted CA9+ population showed increased mRNA level of a Wnt signaling factor AXIN2. In conclusion, these observations indicate that CA9 expression in normal crypt base cells has association with intestinal epithelial stemness
26617789 miR-374a functions as an oncogene in osteosarcoma, and the miR-374a/Axin2 axis might represent a potential therapeutic target for OS intervention.
26514524 Increase in AXIN2 level expression is associated with breast cancer.
26406231 study supports the relationship between AXIN2 mutation and non-syndromic oligodontia and extends the mutation spectrum of the AXIN2 gene.
26337638 rs9675316 located on chr17q23-a24 near the AXIN2 gene was the most significantly associated with hallux valgus in males in genome-wide association meta-analyses.
26252180 Axin2, a tumor suppressor, exhibited a marked inhibitory effect on Eca109 cell growth. The results identified a new role of miR-374a in esophageal cancer involving Axin2 suppression
26191213 Suggest that miR-107 could promote HCC cell proliferation via targeting Axin2.
26025668 Our data suggest the AXIN2 1989G>A mutation may not have solely a loss-of-function role in colorectal cancer
25974148 AXIN2 rs2240308 polymorphism significantly and race-specifically correlates with decreased cancer risk (Meta-Analysis)
More...

AA Sequence

MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNEDGLGEPEGRAS      1 - 70
PDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIE     71 - 140
NNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYVRSGGENTAYM    141 - 210
SNGGLGSLKVVCGYLPTLNEEEEWTCADFKCKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPV    211 - 280
NPYHIGSGYVFAPATSANDSEISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLP    281 - 350
HFPRTHRLPKEMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ    351 - 420
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPA    421 - 490
AASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHCFCPGGSEYYCYSKCKSHSK    491 - 560
APETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAPGGAGALQLPREEGDRSQDVWQWMLESERQS    561 - 630
KPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEA    631 - 700
CRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFF    701 - 770
CGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE    771 - 840
RID                                                                       841 - 843
//

Text Mined References (96)

PMID Year Title
26771938 2016 AXIN2 expression predicts prostate cancer recurrence and regulates invasion and tumor growth.
26648507 2016 Characteristics of carbonic anhydrase 9 expressing cells in human intestinal crypt base.
26617789 2015 MiR-374a promotes the proliferation of osteosarcoma cell proliferation by targeting Axin2.
26514524 2015 AXIN2 Polymorphisms, the ?-Catenin Destruction Complex Expression Profile and Breast Cancer Susceptibility.
26406231 2015 A Novel AXIN2 Missense Mutation Is Associated with Non-Syndromic Oligodontia.
26337638 2015 Genome-wide association meta-analyses to identify common genetic variants associated with hallux valgus in Caucasian and African Americans.
26252180 2015 MicroRNA-374a promotes esophageal cancer cell proliferation via Axin2 suppression.
26191213 2015 miR-107 promotes hepatocellular carcinoma cell proliferation by targeting Axin2.
26025668 2015 An AXIN2 Mutant Allele Associated With Predisposition to Colorectal Neoplasia Has Context-Dependent Effects on AXIN2 Protein Function.
25974148 2015 Quantitative assessment of the association between AXIN2 rs2240308 polymorphism and cancer risk.
More...