Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $113,798.67
PubMed Score 4.33
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y2S6 Q9P052
Symbols CCDC72
HSPC016

Gene

 Grant Application (2)

 Compartment GO Term (0)

Gene RIF (3)

PMID Text
22571579 Dermal papillae cells (DPC) lose aggregate behavior and grow much slower after HSPC016 gene inhibition. Recombinant HSPC016 protein promoted the proliferation of high-passage DPC and induced aggregative behaviour.
16096800 HSPC016 was was differentially expressed in dermal papilla cells with aggregative behavior.
15740594 Expression of gene HSPCO16 resulted in the apoptosis of these cells, which suggested that the apoptosis of dermal papilla cells might be associated with the expression of gene HSPC016 in vitro.

AA Sequence

MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK            1 - 64
//

Text Mined References (9)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
22571579 2012 Effect of HSPC016 gene expression on the aggregative growth of dermal papillae cells.
21269460 2011 Initial characterization of the human central proteome.
16096800 2005 Identification of differentially expressed genes HSPC016 in dermal papilla cells with aggregative behavior.
15740594 2005 Apoptosis of the dermal papilla cells of hair follicle associated with the expression of gene HSPCO16 in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.