Property Summary

NCBI Gene PubMed Count 11
PubMed Score 26.56
PubTator Score 7.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.12204831887065E-10
malignant mesothelioma 3163 9.33467716278613E-7
ulcerative colitis 2087 3.04753021526351E-5
adrenocortical carcinoma 1427 2.22917357024863E-4
sonic hedgehog group medulloblastoma 1482 3.38633377445321E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00304518984607818
medulloblastoma, large-cell 6234 0.00402032464592842
nephrosclerosis 329 0.00522906949813643
active Crohn's disease 918 0.0118647618566386
osteosarcoma 7933 0.0311366124176041

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis -1.224 0.005
malignant mesothelioma -1.600 0.000
osteosarcoma -1.215 0.031
sonic hedgehog group medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.400 0.004
adrenocortical carcinoma -1.086 0.000
pancreatic ductal adenocarcinoma liver m... -2.168 0.003
active Crohn's disease -1.100 0.012
ulcerative colitis -1.400 0.000
ovarian cancer -2.100 0.000

Synonym

Accession Q9Y2S2 A0PJ43 B3KN92 Q0VDI1 Q7Z4Z9 Q9P0G7
Symbols GDH
HEL30
lambda-CRY

Gene

PANTHER Protein Class (2)

PDB

3F3S  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (1)

PMID Text
3170592 rabbit lambda-crystallin constitutes 7-8% of total lens protein

AA Sequence

MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEE      1 - 70
QLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQ     71 - 140
CIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLV    141 - 210
EEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKV    211 - 280
NQDMCMKVPDDPEHLAARRQWRDECLMRLAKLKSQVQPQ                                   281 - 319
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15809331 2005 Structural and functional characterization of rabbit and human L-gulonate 3-dehydrogenase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
More...