Property Summary

NCBI Gene PubMed Count 11
PubMed Score 28.93
PubTator Score 7.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.100 1.2e-02
adrenocortical carcinoma -1.086 2.2e-04
group 3 medulloblastoma -1.400 4.0e-03
malignant mesothelioma -1.600 9.3e-07
medulloblastoma, large-cell -1.400 4.0e-03
nephrosclerosis -1.224 5.2e-03
osteosarcoma -1.215 3.1e-02
ovarian cancer -2.100 1.1e-10
pancreatic ductal adenocarcinoma liver m... -2.168 3.0e-03
ulcerative colitis -1.400 3.0e-05

Synonym

Accession Q9Y2S2 A0PJ43 B3KN92 Q0VDI1 Q7Z4Z9 Q9P0G7
Symbols GDH
HEL30
lambda-CRY

Gene

PANTHER Protein Class (2)

PDB

3F3S  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MASSAAGCVVIVGSGVIGRSWAMLFASGGFQVKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEE      1 - 70
QLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQ     71 - 140
CIVAHPVNPPYYIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLV    141 - 210
EEGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNAEGMLSYCDRYSEGIKHVLQTFGPIPEFSRATAEKV    211 - 280
NQDMCMKVPDDPEHLAARRQWRDECLMRLAKLKSQVQPQ                                   281 - 319
//

Text Mined References (14)

PMID Year Title