Property Summary

NCBI Gene PubMed Count 31
PubMed Score 49.19
PubTator Score 23.20

Knowledge Summary

Patent

No data available

Synonym

Accession P0DPB5 Q5TBX2 Q96BR3 Q9Y2S0
Symbols AC19
RPA9
TCS2
RPA16
RPAC2
RPC16
POLR1C
RPO1-3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDK      1 - 70
EPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR                       71 - 122
//

Text Mined References (34)

PMID Year Title