Property Summary

NCBI Gene PubMed Count 31
PubMed Score 49.19
PubTator Score 23.20

Knowledge Summary

Patent

No data available

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDK      1 - 70
EPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR                       71 - 122
//

Text Mined References (34)

PMID Year Title