Property Summary

NCBI Gene PubMed Count 17
Grant Count 94
R01 Count 57
Funding $13,582,947.32
PubMed Score 523.19
PubTator Score 7.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.096 0.015
lung cancer 1.600 0.001
non primary Sjogren syndrome sicca 1.400 0.021
ovarian cancer 1.400 0.001

Synonym

Accession Q9Y2R9 B2R9N5 Q53GD6 MRP-S7
Symbols S7mt
MRP-S
RP-S7
RPMS7
MRP-S7
bMRP27a

Gene

PDB

3J9M  

Gene RIF (2)

PMID Text
25556185 Study identified MRPS7 mutation as a novel cause of congenital sensorineural deafness and progressive hepatic and renal failure.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKK      1 - 70
TQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN     71 - 140
PYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLL    141 - 210
EAFHNQGPVIKRKHDLHKMAEANRALAHYRWW                                          211 - 242
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25556185 2015 Mutation in mitochondrial ribosomal protein S7 (MRPS7) causes congenital sensorineural deafness, progressive hepatic and renal failure and lactic acidemia.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...