Property Summary

NCBI Gene PubMed Count 18
PubMed Score 575.98
PubTator Score 7.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.600 6.6e-04
non primary Sjogren syndrome sicca 1.400 2.1e-02
ovarian cancer 1.400 7.9e-04
pancreatic ductal adenocarcinoma liver m... -1.096 1.5e-02

Gene RIF (2)

AA Sequence

MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKK      1 - 70
TQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN     71 - 140
PYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLL    141 - 210
EAFHNQGPVIKRKHDLHKMAEANRALAHYRWW                                          211 - 242
//

Text Mined References (23)

PMID Year Title