Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALP      1 - 70
VPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ               71 - 130
//

Text Mined References (12)

PMID Year Title