Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.62
PubTator Score 2.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
ovarian cancer 8492 7.97887361898034E-10
atypical teratoid / rhabdoid tumor 4369 2.32351276839025E-8
group 4 medulloblastoma 1875 1.12640478906365E-7
medulloblastoma, large-cell 6234 5.46866564675771E-7
primitive neuroectodermal tumor 3031 6.60647694207112E-6
tuberculosis and treatment for 6 months 686 1.36618393858528E-5
lung cancer 4473 2.1837781409082E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00748903329284474
colon cancer 1475 0.0155815611653705
non primary Sjogren syndrome sicca 840 0.0217569467465306
Disease Target Count Z-score Confidence
Congenital diaphragmatic hernia 44 3.027 1.5
Disease Target Count
Chromosome 17q12 deletion syndrome 16

Synonym

Accession Q9Y2R4 Q86YG1 Q8N213 Q9NVE0 Q9Y482
Symbols ROK1
HUSSY19

Gene

PDB

3DKP  

  Ortholog (13)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (2)

PMID Text
25701821 siRNA knockdown of DDX52 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.
25701821 siRNA knockdown of DDX52 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV demonstrates decreased infectivity.

AA Sequence

MDVHDLFRRLGAGAKFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFGNKKSVPGVCGASQTHQKPQN      1 - 70
GEKKEESLTERKREQSKKKRKTMTSEIASQEEGATIQWMSSVEAKIEDKKVQRESKLTSGKLENLRKEKI     71 - 140
NFLRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAP    141 - 210
TGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKFGP    211 - 280
KSSKKFDILVTTPNRLIYLLKQDPPGIDLASVEWLVVDESDKLFEDGKTGFRDQLASIFLACTSHKVRRA    281 - 350
MFSATFAYDVEQWCKLNLDNVISVSIGARNSAVETVEQELLFVGSETGKLLAMRELVKKGFNPPVLVFVQ    351 - 420
SIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGIDFKGVNLVINYDFP    421 - 490
TSSVEYIHRIGRTGRAGNKGKAITFFTEDDKPLLRSVANVIQQAGCPVPEYIKGFQKLLSKQKKKMIKKP    491 - 560
LERESISTTPKCFLEKAKDKQKKVTGQNSKKKVALEDKS                                   561 - 599
//

Text Mined References (18)

PMID Year Title
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20941364 2010 Comparative structural analysis of human DEAD-box RNA helicases.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...