Property Summary

NCBI Gene PubMed Count 448
Grant Count 106
R01 Count 50
Funding $12,867,868.68
PubMed Score 504.48
PubTator Score 1250.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
chronic lymphosyte leukemia 1.400 0.000
malignant mesothelioma -2.200 0.000
cutaneous lupus erythematosus 2.400 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.014
lung cancer -2.600 0.000
interstitial cystitis 2.200 0.005
primary Sjogren syndrome 1.800 0.001
lung carcinoma -3.600 0.000
ductal carcinoma in situ 1.100 0.024
psoriasis 1.400 0.000

Synonym

Accession Q9Y2R2 A0N0K6 B1ALC8 D4NZ71 E9PLD8 E9PPI1 O95063 O95064 Q6IPX8 Q8WVM1
Symbols LYP
PEP
LYP1
LYP2
PTPN8

Gene

PDB

2P6X   2QCJ   2QCT   3BRH   3H2X   3OLR   3OMH   4J51  

MLP Assay (21)

AID Type Active / Inconclusive / Inactive Description
606 confirmatory 5 / 0 / 51938 HTS for LYP Inhibitors-an Autoimmunity Target - Primary screen
640 screening 199 / 0 / 96210 LYP Inhibitors-an Autoimmunity Target - Primary screen
697 screening 103 / 0 / 96306 LYP Activators-an Autoimmunity Target - Primary screen
1031 other 0 / 0 / 102 LYP Activators-an Autoimmunity Target - Single Concentration Confirmatory Screen
1253 confirmatory 11 / 0 / 175 LYP Inhibitors - Confirmatory Screen
1779 confirmatory 157 / 0 / 292326 uHTS identification of small molecule inhibitors of LYP via a fluorescence intensity assay
1784 summary 0 / 0 / 0 Summary of small molecule inhibitors of LYP via a fluorescence intensity assay
2126 confirmatory 11 / 0 / 5 LYP1 Fluorescent Assay using OMFP substrate for In Vitro dose response studies.
2135 confirmatory 10 / 0 / 7 SAR LYP1 Fluorescent Assay using pCAP substrate for In Vitro dose response studies
2140 confirmatory 10 / 0 / 6 SAR LYP1 Fluorescent Assay using OMFP substrate for In Vitro dose response studies
More...

Gene RIF (537)

PMID Text
27107590 sex-specific pattern of association is broadly applicable to different populations, and provides further impetus to undertake mechanistic studies to understand the impact of sex on PTPN22 in JIA.
26782543 PTPN22 gene variants were associated with type 1 diabetes susceptibility and autoimmune polyglandular syndrome type III.
26734582 role of PTPN22 in type 1 diabetes and Crohn's disease (review
26631741 rs56048322 was significantly associated with type 1 diabetes. rs56048322 affects splicing, resulting in a novel isoform of LYP which competes with the wild-type for binding to CSK and results in hyporesponsiveness of CD4+ T cells to antigen stimulation.
26554752 Our study suggests the link between periodontitis and RA could be accounted for by P gingivalis infection, and we conclude that P gingivalis is a candidate for triggering and/or driving autoimmunity and autoimmune disease in a subset of RA patients.
26547712 suggests that the rs2476601 polymorphism of PTPN22 gene is mono-morphic in Iranian population, containing only C allele
26458874 Our results do not support association between PTPN22/CSK and Henoch-Schonlein purpura
26429315 The findings suggest that PTPN22 polymorphisms may predispose the chronicity or the development of cirrhosis and hepatocellular carcinoma in HBV infection.
26318187 a significant association between PTPN22 R620W polymorphism and MG risk: PTPN22 R620W polymorphism showed increased early-onset myasthenia gravis (EOMG) risk (OR=2.38; 95% CI, 1.52-3.71; I(2)=0%)(Meta-Analysis)
26291515 The association of PTPN22 rs2476601 with juvenile idiopathic arthritis is specific to females
More...

AA Sequence

MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSR      1 - 70
VELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCE     71 - 140
RYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPSSIDPILELIW    141 - 210
DVRCYQEDDSVPICIHCSAGCGRTGVICAIDYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYE    211 - 280
LVYNAVLELFKRQMDVIRDKHSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKE    281 - 350
SSSFDFRTSEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL    351 - 420
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSCFVEMQAQKVM    421 - 490
HVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSWPPSGTSSKMSLDLPEKQDGT    491 - 560
VFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQESAVLATAPRIDDEIPPPLPVRTPESFIVVEE    561 - 630
AGEFSPNVPKSLSSAVKVKIGTSLEWGGTSEPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPER    631 - 700
TLESFFLADEDCMQAQSIETYSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNK    701 - 770
PAESVQSNNSSSFLNFGFANRFSKPKGPRNPPPTWNI                                     771 - 807
//

Text Mined References (453)

PMID Year Title
27107590 2016 Association of juvenile idiopathic arthritis with PTPN22 rs2476601 is specific to females in a Greek population.
26782543 2015 Association of TNF-?, CTLA4, and PTPN22 polymorphisms with type 1 diabetes and other autoimmune diseases in Brazil.
26734582 2015 Genetic Variations of PTPN2 and PTPN22: Role in the Pathogenesis of Type 1 Diabetes and Crohn's Disease.
26631741 2016 Targeted Deep Sequencing in Multiple-Affected Sibships of European Ancestry Identifies Rare Deleterious Variants in PTPN22 That Confer Risk for Type 1 Diabetes.
26554752 2016 Antibodies to Porphyromonas gingivalis Indicate Interaction Between Oral Infection, Smoking, and Risk Genes in Rheumatoid Arthritis Etiology.
26547712 2015 Single Nucleotide Polymorphism rs 2476601 of PTPN22 Gene and Susceptibility to Rheumatoid Arthritis in Iranian Population.
26458874 2015 Role of PTPN22 and CSK gene polymorphisms as predictors of susceptibility and clinical heterogeneity in patients with Henoch-Schönlein purpura (IgA vasculitis).
26429315 2015 Association of PTPN22 gene polymorphisms with chronic hepatitis B virus infection in Chinese Han population.
26318187 2015 PTPN22 R620W Polymorphism is Associated with Myasthenia Gravis Risk: A Systematic Review and Meta-Analysis.
26291515 2015 The association of PTPN22 rs2476601 with juvenile idiopathic arthritis is specific to females.
More...