Property Summary

Ligand Count 34
NCBI Gene PubMed Count 481
PubMed Score 543.91
PubTator Score 1250.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count
Vasculitis 80
Abdominal Pain 98
Abnormal eyelashes 13
Abnormality of the hypothalamus-pituitary axis 12
Abnormality of the oral cavity 4
Alopecia 115
Angle class 2 malocclusion 57
Angle class 3 malocclusion 57
Anorexia 43
Anti-nuclear factor positive 18
Apraxias 27
Arthralgia 90
Arthritis 290
Brain Ischemia 110
C-reactive protein increased 15
Cataract 297
Cellulitis of periorbital region 13
Cerebral Ischemia 37
Chest Pain 38
Chronic Obstructive Airway Disease 37
Coughing 25
Decreased joint mobility 53
Depressive disorder 409
Diabetes Mellitus, Insulin-Dependent 48
Difficulty chewing 3
ESR raised 20
Elevated C-reactive protein level 15
Epistaxis 43
Exanthema 43
Eyebrow abnormalities 12
Fatigue 182
Fever 138
Giant cell arteritis 7
Glaucoma 239
Granulomatosis 7
Granulomatosis with polyangiitis 5
Headache 37
Hematuria 36
Hemoptysis 6
Impaired cognition 96
Infiltrate of lung 17
Inflammatory abnormality of the eye 10
Iridocyclitis 19
Joint stiffness 84
Joint swelling 26
Juvenile rheumatoid arthritis 111
Lens Opacities 231
Low Vision 174
Malocclusion 57
Mental impairment 95
Nausea and vomiting 97
Ophthalmoparesis 11
Papule 43
Paranasal Sinus Diseases 34
Pauciarticular juvenile rheumatoid arthritis 9
Periorbital edema 13
Periorbital swelling 13
Poliosis 2
Polyarthritis 11
Premature canities 24
Proteinuria 144
Pulmonary Fibrosis 106
Recurrent intrapulmonary hemorrhage 4
Recurrent respiratory infections 141
Renal glomerular disease 12
Respiratory Insufficiency 132
Respiratory function loss 121
Retinal Detachment 51
Sensorineural Hearing Loss (disorder) 284
Short stature 531
Sinusitis 65
Sparse scalp hair 42
Uveomeningoencephalitic Syndrome 3
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 6 1
Visual Impairment 174
Weight decreased 103
hypopigmented skin patch 59
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.653 2.3

Expression

  Differential Expression (10)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.240 1.2e-03
cutaneous lupus erythematosus 2.400 3.9e-04
ductal carcinoma in situ 1.100 2.4e-02
interstitial cystitis 2.200 4.9e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.4e-02
lung cancer -2.600 1.4e-04
lung carcinoma -3.500 1.5e-27
malignant mesothelioma -2.200 4.5e-07
primary Sjogren syndrome 1.400 1.2e-03
psoriasis 1.400 1.2e-44

Protein-protein Interaction (1)

Gene RIF (570)

AA Sequence

MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSR      1 - 70
VELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCE     71 - 140
RYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPSSIDPILELIW    141 - 210
DVRCYQEDDSVPICIHCSAGCGRTGVICAIDYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYE    211 - 280
LVYNAVLELFKRQMDVIRDKHSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKE    281 - 350
SSSFDFRTSEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL    351 - 420
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSCFVEMQAQKVM    421 - 490
HVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSWPPSGTSSKMSLDLPEKQDGT    491 - 560
VFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQESAVLATAPRIDDEIPPPLPVRTPESFIVVEE    561 - 630
AGEFSPNVPKSLSSAVKVKIGTSLEWGGTSEPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPER    631 - 700
TLESFFLADEDCMQAQSIETYSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNK    701 - 770
PAESVQSNNSSSFLNFGFANRFSKPKGPRNPPPTWNI                                     771 - 807
//

Text Mined References (486)

PMID Year Title