Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.00
PubTator Score 1.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Mammary Neoplasms 410

Expression

Synonym

Accession Q9Y2Q9 B2RDZ7 Q96Q21 MRP-S28
Symbols MRPS35
HSPC007
MRP-S28
MRP-S35

Gene

PDB

3J9M  

 GO Function (1)

Gene RIF (2)

PMID Text
22190034 HIV-1 Rev is identified to have a physical interaction with mitochondrial ribosomal protein S28 (MRPS28) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQ      1 - 70
KGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRV     71 - 140
RLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK                           141 - 187
//

Text Mined References (19)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...