Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.00
PubTator Score 1.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425

Expression

 GO Function (1)

Gene RIF (2)

AA Sequence

MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQ      1 - 70
KGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRV     71 - 140
RLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK                           141 - 187
//

Text Mined References (20)

PMID Year Title