Property Summary

Ligand Count 2
NCBI Gene PubMed Count 38
PubMed Score 12.99
PubTator Score 2053.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Osteoarthritis 184 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count
Degenerative polyarthritis 115

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.600 2.4e-04
malignant mesothelioma -1.300 2.0e-06
Multiple myeloma 1.100 8.6e-04
osteosarcoma -1.570 1.2e-04
ovarian cancer 2.200 7.9e-07
subependymal giant cell astrocytoma 1.454 1.7e-02
tuberculosis 1.600 1.0e-09

Synonym

Accession Q9Y2Q3 B4DIH1 B4DSY2 Q6P4H0 Q7Z520 Q9P1S4
Symbols GST
GST13
hGSTK1
GSTK1-1
GST13-13
GST 13-13

Gene

PDB

1YZX   3RPN   3RPP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (5)

Gene RIF (18)

AA Sequence

MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDL      1 - 70
KLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILA     71 - 140
AAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLL    141 - 210
GEKWMGPIPPAVNARL                                                          211 - 226
//

Text Mined References (44)

PMID Year Title