Property Summary

NCBI Gene PubMed Count 32
Grant Count 4
R01 Count 3
Funding $243,094.81
PubMed Score 10.33
PubTator Score 2053.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.100 0.001
malignant mesothelioma -1.300 0.000
osteosarcoma -1.570 0.000
glioblastoma 1.600 0.000
tuberculosis 1.600 0.000
subependymal giant cell astrocytoma 1.454 0.017
ovarian cancer 2.200 0.000

Synonym

Accession Q9Y2Q3 B4DIH1 B4DSY2 Q6P4H0 Q7Z520 Q9P1S4
Symbols GST
GST13
hGSTK1
GSTK1-1
GST13-13
GST 13-13

Gene

PANTHER Protein Class (1)

PDB

1YZX   3RPN   3RPP  

Gene RIF (14)

PMID Text
25739441 DsbA-L is localized in both the mitochondria and the endoplasmic reticulum (ER) in adipocytes; its ER localization plays a critical role in suppressing ER stress and promoting adiponectin biosynthesis and secretion.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of glutathione S-transferase kappa 1 (GSTK1) expression by HIV-1 Vpr in Vpr transduced macrophages
23426619 we have optimized the GST-Nck1-SH2 pull-down procedure to obtain tyrosine-phosphorylated proteins in tumor tissues
23330092 drug resistance in three strains of tumor cells is associated with significant increase in hGSTP1 and hGSTA4 gene expression, whereas increased hGSTK1 gene expression was detected only in resistant erythroleukemia and mammary adenocarcinoma cells.
20472488 This study does not give evidence of interaction between the GST polymorphisms and smoking may although this study provided sufficient statistical power to detect modest interaction.
19639233 The objective of this study was to investigate the molecular mechanisms underlying Group B Streptococcus-human umbilical vein endothelial cells interaction, focusing specifically on the responsiveness of host protein tyrosine kinase (PTK).
19225211 SNP-1308G/T (rs1917760) genotypes of DsbA-L gene might participate in insulin secretion and body fat distribution. It is possible that polymorphisms of DsbA-L gene associated with metabolic diseases[DsbA-L]
19225211 Observational study of gene-disease association. (HuGE Navigator)
18774560 Our results suggest that genetic polymorphisms of xenobiotic-metabolizing enzymes could play an important role in infertility.
17601350 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDL      1 - 70
KLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILA     71 - 140
AAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLL    141 - 210
GEKWMGPIPPAVNARL                                                          211 - 226
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25739441 2015 Endoplasmic reticulum (ER) localization is critical for DsbA-L protein to suppress ER stress and adiponectin down-regulation in adipocytes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23426619 2013 Detection of tyrosine?phosphorylated proteins in hepatocellular carcinoma tissues using a combination of GST?Nck1?SH2 pull?down and two?dimensional electrophoresis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23330092 2012 Expression of genes of glutathione transferase isoforms GSTP1-1, GSTA4-4, and GSTK1-1 in tumor cells during the formation of drug resistance to cisplatin.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
20472488 2010 GST polymorphisms, interaction with smoking and pesticide use, and risk for Parkinson's disease in a Japanese population.
More...