Property Summary

NCBI Gene PubMed Count 20
PubMed Score 34.34
PubTator Score 52.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 1.61483801847758E-16
oligodendroglioma 2849 1.10841078402362E-8
atypical teratoid / rhabdoid tumor 4369 5.09987284932568E-8
psoriasis 6685 1.60524235576308E-7
ovarian cancer 8492 1.66407925150841E-7
medulloblastoma, large-cell 6234 4.13785200485837E-7
lung cancer 4473 7.62532729292845E-7
pediatric high grade glioma 2712 8.92626217425429E-7
pilocytic astrocytoma 3086 1.18008628819774E-6
ulcerative colitis 2087 7.42922808297296E-6
glioblastoma 5572 1.19990679872933E-5
Pick disease 1893 1.98218155133213E-5
group 4 medulloblastoma 1875 3.41443552612872E-5
osteosarcoma 7933 1.66226372614352E-4
limb girdle muscular dystrophy 2A 156 3.29647505508525E-4
pituitary cancer 1972 4.45102000984444E-4
primary Sjogren syndrome 789 0.00113989137496862
Breast cancer 3099 0.00710638027252473
adrenocortical carcinoma 1427 0.00716149326525231
progressive supranuclear palsy 674 0.00816830837996457
primitive neuroectodermal tumor 3031 0.00945398481219634
hereditary spastic paraplegia 313 0.0127573250940988
astrocytoma 1493 0.0130866902649939
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0188954994948995
Waldenstrons macroglobulinemia 765 0.0197838994883701
ependymoma 2514 0.0295250188438876
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 2.0

Expression

  Differential Expression (26)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.246 0.020
astrocytoma -2.400 0.013
ependymoma -1.400 0.030
psoriasis -1.200 0.000
glioblastoma -3.200 0.000
oligodendroglioma -1.300 0.000
osteosarcoma -2.594 0.000
group 4 medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell 2.700 0.000
primitive neuroectodermal tumor -1.700 0.009
hereditary spastic paraplegia -1.066 0.013
limb girdle muscular dystrophy 2A -1.021 0.000
adrenocortical carcinoma -1.139 0.007
non-small cell lung cancer -2.534 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.019
lung cancer -3.000 0.000
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -1.700 0.000
primary Sjogren syndrome 1.100 0.001
Pick disease -2.400 0.000
progressive supranuclear palsy -2.200 0.008
Breast cancer -1.100 0.007
ulcerative colitis -1.400 0.000
ovarian cancer -2.400 0.000
pituitary cancer 1.400 0.000

Synonym

Accession Q9Y2Q0 Q32M35 Q32M36 Q4W5J7 Q4W5P2
Symbols ATPIA
ATPP2
ATPASEII

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
25595798 Depletion of ATP8A1 impaired the asymmetric transbilayer distribution of phosphatidylserine in recycling endosomes, dissociated EHD1 from recycling endosomes, and generated aberrant endosomal tubules that appear resistant to fission.
23269685 the phospholipid flippase complex of ATP8A1 and CDC50A proteins has a role in cell migration
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17229723 APLT has a role in macrophage-induced nitrosylation/oxidation plays an important role in cell clearance

AA Sequence

MPTMRRTVSEIRSRAEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNIITFLPRFLY      1 - 70
SQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRN     71 - 140
GAWEIVHWEKVAVGEIVKVTNGEHLPADLISLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDVD    141 - 210
SLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNS    211 - 280
TSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLNLNYGGASNFGLNFLTFIIL    281 - 350
FNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQ    351 - 420
FKKCTIAGVAYGHVPEPEDYGCSPDEWQNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTA    421 - 490
VPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVIV    491 - 560
RTPSGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFQEWRAVYQRAS    561 - 630
TSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCK    631 - 700
LLKKNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKA    701 - 770
VICCRVSPLQKSEVVEMVKKQVKVVTLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYL    771 - 840
KNLLMIHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGI    841 - 910
FERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTAFGNGKTSDYLLL    911 - 980
GNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAIPMAPDMSGEAAMLFSSGV    981 - 1050
FWMGLLFIPVASLLLDVVYKVIKRTAFKTLVDEVQELEAKSQDPGAVVLGKSLTERAQLLKNVFKKNHVN   1051 - 1120
LYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPDEW                             1121 - 1164
//

Text Mined References (25)

PMID Year Title
25595798 2015 Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23269685 2013 Role for phospholipid flippase complex of ATP8A1 and CDC50A proteins in cell migration.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21914794 2011 ATP9B, a P4-ATPase (a putative aminophospholipid translocase), localizes to the trans-Golgi network in a CDC50 protein-independent manner.
20961850 2010 CDC50 proteins are critical components of the human class-1 P4-ATPase transport machinery.
20947505 2010 Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
More...