Property Summary

NCBI Gene PubMed Count 21
PubMed Score 35.48
PubTator Score 52.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
lung cancer -1.700 3.4e-04
adrenocortical carcinoma -1.139 7.2e-03
adult high grade glioma -1.500 8.1e-04
astrocytic glioma -1.600 3.1e-02
Astrocytoma, Pilocytic -1.800 1.1e-06
atypical teratoid / rhabdoid tumor -4.200 5.1e-08
Breast cancer -1.100 7.1e-03
ependymoma -1.400 3.0e-02
glioblastoma -2.000 7.2e-05
group 4 medulloblastoma -2.200 3.4e-05
hereditary spastic paraplegia -1.066 1.3e-02
intraductal papillary-mucinous carcinoma... 1.200 1.9e-02
limb girdle muscular dystrophy 2A -1.021 3.3e-04
medulloblastoma, large-cell 2.700 4.1e-07
non-small cell lung cancer -2.534 1.6e-16
oligodendroglioma -1.300 1.1e-08
osteosarcoma -2.594 1.7e-04
ovarian cancer -2.400 1.7e-07
Pick disease -2.400 2.0e-05
pituitary cancer 1.400 4.5e-04
primary Sjogren syndrome 1.100 1.1e-03
primitive neuroectodermal tumor -1.700 9.5e-03
progressive supranuclear palsy -2.200 8.2e-03
psoriasis -1.200 1.6e-07
ulcerative colitis -1.100 7.7e-04
Waldenstrons macroglobulinemia -1.246 2.0e-02

Gene RIF (6)

AA Sequence

MPTMRRTVSEIRSRAEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNIITFLPRFLY      1 - 70
SQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIEDIKRHKADNAVNKKQTQVLRN     71 - 140
GAWEIVHWEKVAVGEIVKVTNGEHLPADLISLSSSEPQAMCYIETSNLDGETNLKIRQGLPATSDIKDVD    141 - 210
SLMRISGRIECESPNRHLYDFVGNIRLDGHGTVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNS    211 - 280
TSPPLKLSNVERITNVQILILFCILIAMSLVCSVGSAIWNRRHSGKDWYLNLNYGGASNFGLNFLTFIIL    281 - 350
FNNLIPISLLVTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNEELGQVKYIFSDKTGTLTCNVMQ    351 - 420
FKKCTIAGVAYGHVPEPEDYGCSPDEWQNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTA    421 - 490
VPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKRMSVIV    491 - 560
RTPSGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFATEGLRTLCFAVAEISESDFQEWRAVYQRAS    561 - 630
TSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLMKADIKIWILTGDKQETAINIGHSCK    631 - 700
LLKKNMGMIVINEGSLDGTRETLSRHCTTLGDALRKENDFALIIDGKTLKYALTFGVRQYFLDLALSCKA    701 - 770
VICCRVSPLQKSEVVEMVKKQVKVVTLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYL    771 - 840
KNLLMIHGAWNYNRVSKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGI    841 - 910
FERSCRKENMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTAFGNGKTSDYLLL    911 - 980
GNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAIPMAPDMSGEAAMLFSSGV    981 - 1050
FWMGLLFIPVASLLLDVVYKVIKRTAFKTLVDEVQELEAKSQDPGAVVLGKSLTERAQLLKNVFKKNHVN   1051 - 1120
LYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYDTTKQRPDEW                             1121 - 1164
//

Text Mined References (26)

PMID Year Title