Property Summary

NCBI Gene PubMed Count 19
Grant Count 16
R01 Count 14
Funding $1,849,290.34
PubMed Score 67.86
PubTator Score 5.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

 GO Component (2)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MATQAHSLSYAGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTG      1 - 70
TTLYYQPGLLYGGSVEHDCSVLRGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLL     71 - 140
KQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGKIKRIRGMAYSVRVSPQMANRIVD    141 - 210
SARSILNKFIPDIYIYTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCA    211 - 280
RLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEEL    281 - 350
KGGDKVLMTCVGIGFSNLSKTLK                                                   351 - 373
//

Text Mined References (21)

PMID Year Title
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...