Property Summary

NCBI Gene PubMed Count 13
Grant Count 50
R01 Count 20
Funding $12,210,927.37
PubMed Score 166.56
PubTator Score 186.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.300 0.000
astrocytoma -1.200 0.010
glioblastoma -1.100 0.023
lung cancer 1.500 0.001
inflammatory breast cancer -1.100 0.021

Gene RIF (5)

PMID Text
23415802 Based on a study of 10 pediatric patients, genetic defects that disrupt bile acid amidation cause fat-soluble vitamin deficiency and growth failure, indicating the importance of bile acid conjugation in lipid absorption.
22089923 Bile acid-CoA ligase deficiency is a new inborn error of bile acid metabolism [case report]
20945272 A promoter polymorphism in the FATP5 is associated with the metabolic syndrome and steatosis.
20945272 Observational study of gene-disease association. (HuGE Navigator)
17266179 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAMLARPWLGPWVPHGLSLAAAA      1 - 70
LALTLLPARLPPGLRWLPADVIFLAKILHLGLKIRGCLSRQPPDTFVDAFERRARAQPGRALLVWTGPGA     71 - 140
GSVTFGELDARACQAAWALKAELGDPASLCAGEPTALLVLASQAVPALCMWLGLAKLGCPTAWINPHGRG    141 - 210
MPLAHSVLSSGARVLVVDPDLRESLEEILPKLQAENIRCFYLSHTSPTPGVGALGAALDAAPSHPVPADL    211 - 280
RAGITWRSPALFIYTSGTTGLPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCL    281 - 350
DLGATCVLAPKFSTSCFWDDCRQHGVTVILYVGELLRYLCNIPQQPEDRTHTVRLAMGNGLRADVWETFQ    351 - 420
QRFGPIRIWEVYGSTEGNMGLVNYVGRCGALGKMSCLLRMLSPFELVQFDMEAAEPVRDNQGFCIPVGLG    421 - 490
EPGLLLTKVVSQQPFVGYRGPRELSERKLVRNVRQSGDVYYNTGDVLAMDREGFLYFRDRLGDTFRWKGE    491 - 560
NVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQLAPGQTFDGEKLYQHVRAWLPAYATPHFIR    561 - 630
IQDAMEVTSTFKLMKTRLVREGFNVGIVVDPLFVLDNRAQSFRPLTAEMYQAVCEGTWRL              631 - 690
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23415802 2013 Genetic defects in bile acid conjugation cause fat-soluble vitamin deficiency.
22089923 2012 Bile acid-CoA ligase deficiency--a new inborn error of bile acid metabolism.
20945272 2010 A promoter polymorphism in the liver-specific fatty acid transport protein 5 is associated with features of the metabolic syndrome and steatosis.
17266179 2007 Candidate gene association study of type 2 diabetes in a nested case-control study of the EPIC-Potsdam cohort - role of fat assimilation.
16552721 2006 Heat shock transcription factor (Hsf)-4b recruits Brg1 during the G1 phase of the cell cycle and regulates the expression of heat shock proteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11980911 2002 Participation of two members of the very long-chain acyl-CoA synthetase family in bile acid synthesis and recycling.
10749848 2000 The human liver-specific homolog of very long-chain acyl-CoA synthetase is cholate:CoA ligase.
More...