Property Summary

NCBI Gene PubMed Count 11
PubMed Score 51.73
PubTator Score 6.82

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia -1.500 4.6e-02
adrenocortical carcinoma -3.137 2.0e-07
Breast cancer -2.800 4.9e-38
cutaneous lupus erythematosus -1.500 2.2e-02
ependymoma 3.000 4.5e-08
interstitial cystitis -2.000 1.9e-03
nasopharyngeal carcinoma -1.400 8.5e-03
periodontitis -1.200 1.1e-19
pituitary cancer 1.800 3.0e-02

Gene RIF (4)

AA Sequence

MLLSWLTVLGAGMVVLHFLQKLLFPYFWDDFWFVLKVVLIIIRLKKYEKRGELVTVLDKFLSHAKRQPRK      1 - 70
PFIIYEGDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFVHVWFGLAKLGCVVAFLNTNIR     71 - 140
SNSLLNCIRACGPRALVVGADLLGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTSPDEPVPRSHH    141 - 210
VVSLLKSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVE    211 - 280
LGATCVLKKKFSASQFWSDCKKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLD    281 - 350
RFGNIKVCELYAATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGE    351 - 420
PGLLISRVNAKNPFFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKGEN    421 - 490
VATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLPAYACPRFLRI    491 - 560
QEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKSYVLLTRELYDQIMLGEIKL               561 - 619
//

Text Mined References (12)

PMID Year Title