Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $103,236.26
PubMed Score 46.72
PubTator Score 6.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus -1.500 0.022
posterior fossa group B ependymoma 3.800 0.000
periodontitis -1.200 0.000
adrenocortical carcinoma -3.137 0.000
interstitial cystitis -2.000 0.002
acute myeloid leukemia -1.500 0.046
nasopharyngeal carcinoma -1.400 0.009
Breast cancer -2.800 0.000
pituitary cancer 1.800 0.030

Synonym

Accession Q9Y2P4 Q6IAM5 Q7Z6E6 Q86YF6 FATP-6
Symbols FATP6
ACSVL2
FACVL2
VLCS-H1

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (4)

PMID Text
21920065 The FATP6-7T>A polymorphism may protect from traits of the metabolic syndrome and CVD.
20965718 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of solute carrier family 27 (fatty acid transporter), member 6 (SLC27A6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12556534 FATP6 is involved in heart LCFA uptake, in which it may play a role in the pathogenesis of lipid-related cardiac disorders.

AA Sequence

MLLSWLTVLGAGMVVLHFLQKLLFPYFWDDFWFVLKVVLIIIRLKKYEKRGELVTVLDKFLSHAKRQPRK      1 - 70
PFIIYEGDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFVHVWFGLAKLGCVVAFLNTNIR     71 - 140
SNSLLNCIRACGPRALVVGADLLGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTSPDEPVPRSHH    141 - 210
VVSLLKSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVE    211 - 280
LGATCVLKKKFSASQFWSDCKKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLD    281 - 350
RFGNIKVCELYAATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGE    351 - 420
PGLLISRVNAKNPFFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKGEN    421 - 490
VATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLPAYACPRFLRI    491 - 560
QEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKSYVLLTRELYDQIMLGEIKL               561 - 619
//

Text Mined References (12)

PMID Year Title
21920065 2012 A variant in the heart-specific fatty acid transport protein 6 is associated with lower fasting and postprandial TAG, blood pressure and left ventricular hypertrophy.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17762044 2007 Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12556534 2003 Characterization of a heart-specific fatty acid transport protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10749848 2000 The human liver-specific homolog of very long-chain acyl-CoA synthetase is cholate:CoA ligase.
10479480 1999 Human liver-specific very-long-chain acyl-coenzyme A synthetase: cDNA cloning and characterization of a second enzymatically active protein.
More...