Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.11
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.0e-07
psoriasis 6694 3.8e-05
oligodendroglioma 2850 1.1e-02

Expression

  Differential Expression (3)

Disease log2 FC p
oligodendroglioma -1.100 1.1e-02
osteosarcoma -2.168 2.0e-07
psoriasis -2.300 3.8e-05

AA Sequence

MEGLLSVALQGAELEGNWKHEGQVEDLQENQESCPEPEAVACKGDPAGDSMQERDEFSRIPRTISSPAAT      1 - 70
QASVPDDSSSRRCSAPGESPKERHPDSRQRERGGGPKKPWKCGDCGKAFSYCSAFILHQRIHTGEKPFAC     71 - 140
PECGKAFSQSVHLTLHQRTHTGEKPYACHECGKAFSQGSYLASHWRTHTGEKPHRCADCGKAFTRVTHLT    141 - 210
QHRRVHTGERPYACAQCAKAFRNRSSLIEHQRIHTGEKPYECSACAKAFRFSSALIRHQRIHTEEKPYRC    211 - 280
GQCAKAFAQIAHLTQHRRVHTGEKPYTCQDCGALFSQSASLAEHRRIHTGEKPYACGQCAKAFTQVSHLT    281 - 350
QHQRTHTGERPYPCHDCGKRFSNRSHLLQHRLVHTGERPYRCLQCGAAFSHVSSLIEHQKIHTGERPYKC    351 - 420
GECGKAFSQGSSLALHQRTHTGERPYTCPECGKAFSNRSYLIQHHIVHTGEKPYECSGCGKAFSFSSALI    421 - 490
RHQRTHADSSGRLCPAPTPDSTPGLSQGGETCQQGCPGRNPRGPAED                           491 - 537
//

Text Mined References (2)

PMID Year Title