Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.11
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 2.0068521266285E-7
psoriasis 6685 3.80112259975079E-5
oligodendroglioma 2849 0.0109785102451434

Expression

  Differential Expression (3)

Disease log2 FC p
oligodendroglioma -1.100 0.011
psoriasis -2.300 0.000
osteosarcoma -2.168 0.000

Synonym

Accession Q9Y2P0 B7Z5Y0 G3V1S0
Symbols BC37295_3

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid

AA Sequence

MEGLLSVALQGAELEGNWKHEGQVEDLQENQESCPEPEAVACKGDPAGDSMQERDEFSRIPRTISSPAAT      1 - 70
QASVPDDSSSRRCSAPGESPKERHPDSRQRERGGGPKKPWKCGDCGKAFSYCSAFILHQRIHTGEKPFAC     71 - 140
PECGKAFSQSVHLTLHQRTHTGEKPYACHECGKAFSQGSYLASHWRTHTGEKPHRCADCGKAFTRVTHLT    141 - 210
QHRRVHTGERPYACAQCAKAFRNRSSLIEHQRIHTGEKPYECSACAKAFRFSSALIRHQRIHTEEKPYRC    211 - 280
GQCAKAFAQIAHLTQHRRVHTGEKPYTCQDCGALFSQSASLAEHRRIHTGEKPYACGQCAKAFTQVSHLT    281 - 350
QHQRTHTGERPYPCHDCGKRFSNRSHLLQHRLVHTGERPYRCLQCGAAFSHVSSLIEHQKIHTGERPYKC    351 - 420
GECGKAFSQGSSLALHQRTHTGERPYTCPECGKAFSNRSYLIQHHIVHTGEKPYECSGCGKAFSFSSALI    421 - 490
RHQRTHADSSGRLCPAPTPDSTPGLSQGGETCQQGCPGRNPRGPAED                           491 - 537
//

Text Mined References (2)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.